Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein |
|---|---|
| Uniprot ID | P25942 |
| Uniprot link | http://www.uniprot.org/uniprot/P25942 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | CREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGSHHHHHH |
| Molecular weight | 19.68kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | 50 mM Tris-HCl, pH 8.0, 150 mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Cys26-Gly187 |
| Aliases /Synonyms | CD40, CDW40, Bp50, P50, B-cell surface antigen CD40, CD40L receptor,TNFRSF5 |
| Reference | PX-P4015 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.