Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P25942
Molecular weight:
19.68kDa

Original price was: $302.00.Current price is: $250.00.

50ug 17% OFF + 250 loyalty points
Cys26–Gly187 Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein
Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein

Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein

Product name Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein
Uniprot ID P25942
Uniprot link http://www.uniprot.org/uniprot/P25942
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence CREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCG
Molecular weight 19.68kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys26-Gly187
Aliases /Synonyms CD40, CDW40, Bp50, P50, B-cell surface antigen CD40, CD40L receptor,TNFRSF5
Reference PX-P4015
Note For research use only
Molecular Constructor
Cys26–Gly187 Yes
Product name Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein
Uniprot ID P25942
Uniprot link http://www.uniprot.org/uniprot/P25942
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence CREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCG
Molecular weight 19.68kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys26-Gly187
Aliases /Synonyms CD40, CDW40, Bp50, P50, B-cell surface antigen CD40, CD40L receptor,TNFRSF5
Reference PX-P4015
Note For research use only
Molecular Constructor
Cys26–Gly187 Yes
Product name PX-P4015-1MG
Uniprot ID P25942
Uniprot link http://www.uniprot.org/uniprot/P25942
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence CREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCG
Molecular weight 19.68kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys26-Gly187
Aliases /Synonyms CD40, CDW40, Bp50, P50, B-cell surface antigen CD40, CD40L receptor,TNFRSF5
Reference PX-P4015
Note For research use only
Molecular Constructor
Cys26–Gly187 Yes

SDS-PAGE for Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein

SDS-PAGE for Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein

Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein

There are no reviews yet.

Be the first to review “Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products