Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD52 Monoclonal Antibody

  • ARO-A15837-50
  • Validated FC WB

Original price was: $336.00.Current price is: $275.00.

50ug 18% OFF + 275 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD52 Monoclonal Antibody

Product name ARO-A15837-100
Uniprot ID P31358
Uniprot link P31358
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference ARO-A15837
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD52
Clone Name SAA0024
Protein Name CD52
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15837-1MG
Uniprot ID P31358
Uniprot link P31358
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference ARO-A15837
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD52
Clone Name SAA0024
Protein Name CD52
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15837-50
Uniprot ID P31358
Uniprot link P31358
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference ARO-A15837
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD52
Clone Name SAA0024
Protein Name CD52
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human CD52 Monoclonal Antibody

Flow Cytometry results for Human CD52 Monoclonal Antibody

Flow-cytometry using anti-human CD52 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an anti-human CD52 monoclonal antibody (Catalog: ARO-A15837) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Mouse IgG H&L Polyclonal Antibody, FITC (abinScience: PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human CD52 Monoclonal Antibody

Flow Cytometry results for Human CD52 Monoclonal Antibody

Flow-cytometry using anti-human CD52 antibody.Human peripheral blood lymphocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD52 antibody monoclonal antibody (Catalog # ARO-A15837 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Human CD52 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD52 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products