Brand: ProteoGenix

Human CD52 Monoclonal Antibody

ARO-A15837-50
Validated FC WB

Original price was: $336.00.Current price is: $275.00.

50ug 18% OFF + 275 loyalty points

Size Size

50ug Original price was: $336.00.Current price is: $275.00.
100ug Original price was: $495.00.Current price is: $393.00.
1MG Original price was: $1,366.00.Current price is: $1,139.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Flow Cytometry results for Human CD52 Monoclonal Antibody

Datasheet

Human CD52 Monoclonal Antibody

Product name	ARO-A15837-100
Uniprot ID	P31358
Uniprot link	P31358
Raw Antigen Sequence	MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Human
Reactivity	Human
Aliases /Synonyms	Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference	ARO-A15837
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD52
Clone Name	SAA0024
Protein Name	CD52
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15837-1MG
Uniprot ID	P31358
Uniprot link	P31358
Raw Antigen Sequence	MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Human
Reactivity	Human
Aliases /Synonyms	Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference	ARO-A15837
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD52
Clone Name	SAA0024
Protein Name	CD52
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15837-50
Uniprot ID	P31358
Uniprot link	P31358
Raw Antigen Sequence	MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Human
Reactivity	Human
Aliases /Synonyms	Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference	ARO-A15837
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD52
Clone Name	SAA0024
Protein Name	CD52
Target species	Anti-Human Monoclonal Antibody

Datasheet

Flow Cytometry results for Human CD52 Monoclonal Antibody

Flow-cytometry using anti-human CD52 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an anti-human CD52 monoclonal antibody (Catalog: ARO-A15837) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Mouse IgG H&L Polyclonal Antibody, FITC (abinScience: PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human CD52 Monoclonal Antibody

Flow-cytometry using anti-human CD52 antibody.Human peripheral blood lymphocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD52 antibody monoclonal antibody (Catalog # ARO-A15837 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Human CD52 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Human CD52 Monoclonal Antibody

Human CD52 Monoclonal Antibody

Flow Cytometry results for Human CD52 Monoclonal Antibody

Flow Cytometry results for Human CD52 Monoclonal Antibody

Related products

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD52 Monoclonal Antibody

Specifications Human CD52 Monoclonal Antibody

Documents

QC & Validation

Flow Cytometry results for Human CD52 Monoclonal Antibody

Flow Cytometry results for Human CD52 Monoclonal Antibody

3D Representation

Reviews

Related products

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD52 Monoclonal Antibody