Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD52 (SAA0023) Monoclonal Antibody

Original price was: $444.00.Current price is: $326.00.

50ug 27% OFF + 326 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD52 (SAA0023) Monoclonal Antibody

Product name ARO-A15834-100
Uniprot ID P31358
Uniprot link P31358
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference ARO-A15834
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD52 (SAA0023)
Clone Name SAA0023
Protein Name CD52 (SAA0023)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15834-1MG
Uniprot ID P31358
Uniprot link P31358
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference ARO-A15834
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD52 (SAA0023)
Clone Name SAA0023
Protein Name CD52 (SAA0023)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15834-50
Uniprot ID P31358
Uniprot link P31358
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Human epididymis-specific protein 5, CDW52, CAMPATH-1 antigen, Cambridge pathology 1 antigen, He5, HE5, Epididymal secretory protein E5, CD52, CDw52
Reference ARO-A15834
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD52 (SAA0023)
Clone Name SAA0023
Protein Name CD52 (SAA0023)
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human CD52 (SAA0023) Monoclonal Antibody

SDS-PAGE for Human CD52 (SAA0023) Monoclonal Antibody

Human CD52 (SAA0023) Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD52 (SAA0023) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD52 (SAA0023) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products