Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD72 Monoclonal Antibody

  • ARO-A15781-50
  • Validated ELISA

Original price was: $286.00.Current price is: $236.00.

50ug 17% OFF + 236 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD72 Monoclonal Antibody

Product name ARO-A15781-100
Uniprot ID P21854
Uniprot link P21854
Raw Antigen Sequence MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD72, Lyb-2, B-cell differentiation antigen CD72
Reference ARO-A15781
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD72
Clone Name W004
Protein Name CD72
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15781-1MG
Uniprot ID P21854
Uniprot link P21854
Raw Antigen Sequence MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD72, Lyb-2, B-cell differentiation antigen CD72
Reference ARO-A15781
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD72
Clone Name W004
Protein Name CD72
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15781-50
Uniprot ID P21854
Uniprot link P21854
Raw Antigen Sequence MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms CD72, Lyb-2, B-cell differentiation antigen CD72
Reference ARO-A15781
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD72
Clone Name W004
Protein Name CD72
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD72 Monoclonal Antibody

SEC-HPLC of Human CD72 Monoclonal Antibody

Human CD72 Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD72 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD72 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products