Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD87/PLAUR/uPAR Monoclonal Antibody

  • ARO-A15785-50
  • Validated ELISA

Original price was: $374.00.Current price is: $275.00.

50ug 26% OFF + 275 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD87/PLAUR/uPAR Monoclonal Antibody binds to Recombinant Human CD87/PLAUR/uPAR, N-His in ELISA Assay
Human CD87/PLAUR/uPAR Monoclonal Antibody

Human CD87/PLAUR/uPAR Monoclonal Antibody

Product name ARO-A15785-100
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15785-1MG
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15785-50
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody

Human CD87/PLAUR/uPAR Monoclonal Antibody binds to Recombinant Human CD87/PLAUR/uPAR, N-His in ELISA Assay

Human CD87/PLAUR/uPAR Monoclonal Antibody binds to Recombinant Human CD87/PLAUR/uPAR, N-His in ELISA Assay

Recombinant Human CD87/PLAUR/uPAR, N-His(cat. No.ARO-P13506) at 0.5µg/mL (100µL/well) can bind Human CD87/PLAUR/uPAR Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

Human CD87/PLAUR/uPAR Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD87/PLAUR/uPAR Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products