Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD87/PLAUR/uPAR Monoclonal Antibody

  • ARO-A15785-50
  • Validated ELISA

Original price was: $374.00.Current price is: $275.00.

50ug 26% OFF + 275 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD87/PLAUR/uPAR Monoclonal Antibody

Product name ARO-A15785-100
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15785-1MG
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15785-50
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD87/PLAUR/uPAR Monoclonal Antibody

SEC-HPLC of Human CD87/PLAUR/uPAR Monoclonal Antibody

Human CD87/PLAUR/uPAR Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD87/PLAUR/uPAR Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD87/PLAUR/uPAR Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products