Brand: ProteoGenix

Human CD90/THY1 Monoclonal Antibody

ARO-A15800-50
Quality Chart

Original price was: $163.00.Current price is: $130.00.

50ug 20% OFF + 130 loyalty points

Size Size

50ug Original price was: $163.00.Current price is: $130.00.
100ug Original price was: $242.00.Current price is: $184.00.
1MG Original price was: $713.00.Current price is: $536.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Flow Cytometry results for Human CD90/THY1 Monoclonal Antibody

Datasheet

8 clones available

Human CD90/THY1 Monoclonal Antibody

Product name	ARO-A15800-100
Uniprot ID	P04216
Uniprot link	P04216
Raw Antigen Sequence	MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference	ARO-A15800
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD90/THY1
Clone Name	H5
Protein Name	CD90/THY1
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15800-1MG
Uniprot ID	P04216
Uniprot link	P04216
Raw Antigen Sequence	MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference	ARO-A15800
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD90/THY1
Clone Name	H5
Protein Name	CD90/THY1
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15800-50
Uniprot ID	P04216
Uniprot link	P04216
Raw Antigen Sequence	MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference	ARO-A15800
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD90/THY1
Clone Name	H5
Protein Name	CD90/THY1
Target species	Anti-Human Monoclonal Antibody

Datasheet

Flow Cytometry results for Human CD90/THY1 Monoclonal Antibody

Jurkat cells were stained with an irrelevant antibody (Blue Histogram) or Human CD90/THY1 Monoclonal Antibody (ARO-A15800 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Mouse IgG Polyclonal Antibody, FITC (PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Human CD90/THY1 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Filter to find the right variant

Clonality

All

Isotype

All

Target Species

All

Applications

All

Name	SKU	View Clone
Anti-Human CD90/THY1 Antibody (H5), FITC	ARO-A10872	View Clone
Human CD90/THY1 Monoclonal Antibody	ARO-A15800	View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), FITC	ARO-A10870	View Clone
Anti-Human CD90/THY1 Antibody (H5), APC	ARO-A10364	View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), APC	ARO-A10362	View Clone
Anti-Human CD90/THY1 Antibody (H5), PerCP	ARO-A10113	View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), PerCP	ARO-A10111	View Clone
Anti-Human CD90/THY1 Antibody (H5), PE	ARO-A10629	View Clone

Human CD90/THY1 Monoclonal Antibody

Human CD90/THY1 Monoclonal Antibody

Flow Cytometry results for Human CD90/THY1 Monoclonal Antibody

Related products

Mouse IgG1 Isotype Control antibody (HyHEL-10)

HRP* Goat Anti-Mouse IgG（H+L）

FITC* Goat Anti-Mouse IgG（H+L）

Human CD90/THY1 Recombinant Protein, C-Fc

Anti-CD90/THY1 Polyclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD90/THY1 Monoclonal Antibody

Specifications Human CD90/THY1 Monoclonal Antibody

Documents

QC & Validation

Flow Cytometry results for Human CD90/THY1 Monoclonal Antibody

3D Representation

Reviews

Available Clones

Related products

Mouse IgG1 Isotype Control antibody (HyHEL-10)

HRP* Goat Anti-Mouse IgG（H+L）

FITC* Goat Anti-Mouse IgG（H+L）

Human CD90/THY1 Recombinant Protein, C-Fc

Anti-CD90/THY1 Polyclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD90/THY1 Monoclonal Antibody