Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD90/THY1 Monoclonal Antibody

Original price was: $163.00.Current price is: $130.00.

50ug 20% OFF + 130 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD90/THY1 Monoclonal Antibody

Product name ARO-A15800-100
Uniprot ID P04216
Uniprot link P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A15800
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD90/THY1
Clone Name H5
Protein Name CD90/THY1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15800-1MG
Uniprot ID P04216
Uniprot link P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A15800
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD90/THY1
Clone Name H5
Protein Name CD90/THY1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15800-50
Uniprot ID P04216
Uniprot link P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A15800
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD90/THY1
Clone Name H5
Protein Name CD90/THY1
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human CD90/THY1 Monoclonal Antibody

Flow Cytometry results for Human CD90/THY1 Monoclonal Antibody

Jurkat cells were stained with an irrelevant antibody (Blue Histogram) or Human CD90/THY1 Monoclonal Antibody (ARO-A15800 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Mouse IgG Polyclonal Antibody, FITC (PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Human CD90/THY1 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD90/THY1 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Isotype
All
Target Species
All
Applications
All

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products