Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CD90/THY1 Antibody (H5), PE

  • ARO-A10629-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG1, kappa
Clone Name:
H5

Original price was: $259.00.Current price is: $209.00.

50ug 19% OFF + 209 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Anti-Human CD90/THY1 Antibody (H5), PE
8 clones available

Anti-Human CD90/THY1 Antibody (H5), PE

Product name ARO-A10629-100
Uniprot ID P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10629
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name H5
Product name ARO-A10629-1MG
Uniprot ID P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10629
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name H5
Product name ARO-A10629-50
Uniprot ID P04216
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference ARO-A10629
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name H5

Flow Cytometry results for Anti-Human CD90/THY1 Antibody (H5), PE

Flow Cytometry results for Anti-Human CD90/THY1 Antibody (H5), PE

Target Cells were stained with an irrelevant antibody or Anti-Human CD90/THY1 Antibody (H5), PE at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD90/THY1 Antibody (H5), PE”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Isotype
All
Target Species
All
Applications
All
Name SKU View Clone
Anti-Human CD90/THY1 Antibody (H5), FITC ARO-A10872 View Clone
Human CD90/THY1 Monoclonal Antibody ARO-A15800 View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), FITC ARO-A10870 View Clone
Anti-Human CD90/THY1 Antibody (H5), APC ARO-A10364 View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), APC ARO-A10362 View Clone
Anti-Human CD90/THY1 Antibody (H5), PerCP ARO-A10113 View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), PerCP ARO-A10111 View Clone
Anti-Human CD90/THY1 Antibody (H5), PE ARO-A10629 View Clone

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products