Brand: ProteoGenix

Anti-Human CD90/THY1 Antibody (H5), FITC

ARO-A10872-50
Quality Chart

Clonality:: Monoclonal Antibody
Host species:: Mouse
Isotype:: IgG1, kappa
Clone Name:: H5

Original price was: $217.00.Current price is: $155.00.

50ug 29% OFF + 155 loyalty points

Size Size

50ug Original price was: $217.00.Current price is: $155.00.
100ug Original price was: $269.00.Current price is: $220.00.
1MG Original price was: $825.00.Current price is: $639.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

8 clones available

Anti-Human CD90/THY1 Antibody (H5), FITC

Product name	ARO-A10872-100
Uniprot ID	P04216
Raw Antigen Sequence	MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference	ARO-A10872
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name	H5

Product name	ARO-A10872-1MG
Uniprot ID	P04216
Raw Antigen Sequence	MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference	ARO-A10872
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name	H5

Product name	ARO-A10872-50
Uniprot ID	P04216
Raw Antigen Sequence	MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Reference	ARO-A10872
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	THY1, CDw90, Thy-1 antigen, Thy-1 membrane glycoprotein, CD90
Clone Name	H5

Datasheet

There are no reviews yet.

Be the first to review “Anti-Human CD90/THY1 Antibody (H5), FITC”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Filter to find the right variant

Clonality

All

Isotype

All

Target Species

All

Applications

All

Name	SKU	View Clone
Anti-Human CD90/THY1 Antibody (H5), FITC	ARO-A10872	View Clone
Human CD90/THY1 Monoclonal Antibody	ARO-A15800	View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), FITC	ARO-A10870	View Clone
Anti-Human CD90/THY1 Antibody (H5), APC	ARO-A10364	View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), APC	ARO-A10362	View Clone
Anti-Human CD90/THY1 Antibody (H5), PerCP	ARO-A10113	View Clone
Anti-Mouse CD90/THY1 Antibody (T24/31), PerCP	ARO-A10111	View Clone
Anti-Human CD90/THY1 Antibody (H5), PE	ARO-A10629	View Clone