Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CDKN3 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q16667
Molecular weight:
23.08 kDa

Original price was: $426.00.Current price is: $387.00.

100ug 9% OFF + 387 loyalty points
His His28–Arg212
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CDKN3 Recombinant Protein, N-His

Human CDKN3 Recombinant Protein, N-His

Product name ARO-P20052-100
Uniprot ID Q16667
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Molecular weight 23.08 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His28-Arg212
Aliases /Synonyms CDI1, CDK2-associated dual-specificity phosphatase, CDKN3, CIP2, Cyclin-dependent kinase inhibitor 3, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC:3.1.3.16, EC:3.1.3.48, KAP, Kinase-associated phosphatase
Reference ARO-P20052
Note For research use only.
Molecular Constructor
His His28–Arg212
Product name ARO-P20052-1MG
Uniprot ID Q16667
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Molecular weight 23.08 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His28-Arg212
Aliases /Synonyms CDI1, CDK2-associated dual-specificity phosphatase, CDKN3, CIP2, Cyclin-dependent kinase inhibitor 3, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC:3.1.3.16, EC:3.1.3.48, KAP, Kinase-associated phosphatase
Reference ARO-P20052
Note For research use only.
Molecular Constructor
His His28–Arg212
Product name ARO-P20052-50
Uniprot ID Q16667
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Molecular weight 23.08 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His28-Arg212
Aliases /Synonyms CDI1, CDK2-associated dual-specificity phosphatase, CDKN3, CIP2, Cyclin-dependent kinase inhibitor 3, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC:3.1.3.16, EC:3.1.3.48, KAP, Kinase-associated phosphatase
Reference ARO-P20052
Note For research use only.
Molecular Constructor
His His28–Arg212

There are no reviews yet.

Be the first to review “Human CDKN3 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products