Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human DCN recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P07585
Molecular weight:
41.20 kDa

Original price was: $425.00.Current price is: $380.00.

100ug 11% OFF + 380 loyalty points
His Asp31–Lys359
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human DCN recombinant protein

Human DCN recombinant protein

Product name PX-P6534-100
Uniprot ID P07585
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Molecular weight 41.20 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp31-Lys359
Aliases /Synonyms Bone proteoglycan II, Decorin, SLRR1B, DCN, PG-S2PG40,
Reference PX-P6534
Molecular Constructor
His Asp31–Lys359
Product name PX-P6534-1MG
Uniprot ID P07585
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Molecular weight 41.20 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp31-Lys359
Aliases /Synonyms Bone proteoglycan II, Decorin, SLRR1B, DCN, PG-S2PG40,
Reference PX-P6534
Molecular Constructor
His Asp31–Lys359
Product name PX-P6534-50
Uniprot ID P07585
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Molecular weight 41.20 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp31-Lys359
Aliases /Synonyms Bone proteoglycan II, Decorin, SLRR1B, DCN, PG-S2PG40,
Reference PX-P6534
Molecular Constructor
His Asp31–Lys359

There are no reviews yet.

Be the first to review “Human DCN recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products