Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human eIF4G Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Molecular weight:
23.49kDa

$250.00

50ug + 250 loyalty points
Glu557~Lys646 N-ter His Trx
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human eIF4G Recombinant Protein

Human eIF4G Recombinant Protein

Product name Human eIF4G Recombinant Protein
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight 23.49kDa
Protein delivered with Tag? N-ter His&Trx Tag
Purity estimated ≥95%
Buffer PBS, imidazole 200mM + 50% glycérol
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu557~Lys646
Protein Accession EAW78268.1
NCBI Reference WP_001583586
Aliases /Synonyms EIF-4G1, EIF4F, EIF4G, EIF4GI, P220, PARK18
Reference PX-P2069
Note For research use only
Molecular Constructor
Glu557~Lys646 N-ter His Trx
Product name Human eIF4G Recombinant Protein
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight 23.49kDa
Protein delivered with Tag? N-ter His&Trx Tag
Purity estimated ≥95%
Buffer PBS, imidazole 200mM + 50% glycérol
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu557~Lys646
Protein Accession EAW78268.1
NCBI Reference WP_001583586
Aliases /Synonyms EIF-4G1, EIF4F, EIF4G, EIF4GI, P220, PARK18
Reference PX-P2069
Note For research use only
Molecular Constructor
Glu557~Lys646 N-ter His Trx

  • Nichols N, Bras JM, Hernandez DG, Jansen IE, Lesage S, Lubbe S, Singleton AB; International Parkinson's Disease Genomics Consortium.. EIF4G1 mutations do not cause Parkinson's disease. Neurobiol Aging. 2015 Aug;36(8):2444.e1-4. doi: 10.1016/j.neurobiolaging.2015.04.017. Epub 2015 May 9. PubMed PMID: 26022768; PubMed Central PMCID: PMC4464946.
  • Deng H, Wu Y, Jankovic J. The EIF4G1 gene and Parkinson's disease. Acta Neurol Scand. 2015 Aug;132(2):73-8. doi: 10.1111/ane.12397. Epub 2015 Mar 13. Review. PubMed PMID: 25765080.
  • Huttenlocher J, Krüger R, Capetian P, Lohmann K, Brockmann K, Csoti I, Klein C, Berg D, Gasser T, Bonin M, Riess O, Bauer P. EIF4G1 is neither a strong nor a common risk factor for Parkinson's disease: evidence from large European cohorts. J Med Genet. 2015 Jan;52(1):37-41. doi: 10.1136/jmedgenet-2014-102570. Epub 2014 Nov 3. PubMed PMID: 25368108.
  • Akabayov SR, Akabayov B, Wagner G. Human translation initiation factor eIF4G1 possesses a low-affinity ATP binding site facing the ATP-binding cleft of eIF4A in the eIF4G/eIF4A complex. Biochemistry. 2014 Oct 21;53(41):6422-5. doi: 10.1021/bi500600m. Epub 2014 Oct 8. PubMed PMID: 25255371; PubMed Central PMCID: PMC4204880.
  • Attar-Schneider O, Drucker L, Zismanov V, Tartakover-Matalon S, Lishner M. Targeting eIF4GI translation initiation factor affords an attractive therapeutic strategy in multiple myeloma. Cell Signal. 2014 Sep;26(9):1878-87. doi: 10.1016/j.cellsig.2014.05.005. Epub 2014 May 9. PubMed PMID: 24815186.
  • Nishioka K, Funayama M, Vilariño-Güell C, Ogaki K, Li Y, Sasaki R, Kokubo Y, Kuzuhara S, Kachergus JM, Cobb SA, Takahashi H, Mizuno Y, Farrer MJ, Ross OA, Hattori N. EIF4G1 gene mutations are not a common cause of Parkinson's disease in the Japanese population. Parkinsonism Relat Disord. 2014 Jun;20(6):659-61. doi: 10.1016/j.parkreldis.2014.03.004. Epub 2014 Mar 18. PubMed PMID: 24704100; PubMed Central PMCID: PMC4034257.
  • Blanckenberg J, Ntsapi C, Carr JA, Bardien S. EIF4G1 R1205H and VPS35 D620N mutations are rare in Parkinson's disease from South Africa. Neurobiol Aging. 2014 Feb;35(2):445.e1-3. doi: 10.1016/j.neurobiolaging.2013.08.023. Epub 2013 Sep 27. PubMed PMID: 24080171.
  • Li K, Tang BS, Guo JF, Lou MX, Lv ZY, Liu ZH, Tian Y, Song CY, Xia K, Yan XX. Analysis of EIF4G1 in ethnic Chinese. BMC Neurol. 2013 Apr 26;13:38. doi: 10.1186/1471-2377-13-38. PubMed PMID: 23617574; PubMed Central PMCID: PMC3663786.
  • Yuan L, Song Z, Xu H, Gu S, Zhu A, Gong L, Zhao Y, Deng H. EIF4G1 Ala502Val and Arg1205His variants in Chinese patients with Parkinson disease. Neurosci Lett. 2013 May 24;543:69-71. doi: 10.1016/j.neulet.2013.02.056. Epub 2013 Apr 2. PubMed PMID: 23562511.
  • Siitonen A, Majounie E, Federoff M, Ding J, Majamaa K, Singleton AB. Mutations in EIF4G1 are not a common cause of Parkinson's disease. Eur J Neurol. 2013 Apr;20(4):e59. doi: 10.1111/ene.12051. PubMed PMID: 23490116.
  • Dobrikov MI, Dobrikova EY, Gromeier M. Dynamic regulation of the translation initiation helicase complex by mitogenic signal transduction to eukaryotic translation initiation factor 4G. Mol Cell Biol. 2013 Mar;33(5):937-46. doi: 10.1128/MCB.01441-12. Epub 2012 Dec 21. PubMed PMID: 23263986; PubMed Central PMCID: PMC3623071.
  • Fujioka S, Sundal C, Strongosky AJ, Castanedes MC, Rademakers R, Ross OA, Vilariño-Güell C, Farrer MJ, Wszolek ZK, Dickson DW. Sequence variants in eukaryotic translation initiation factor 4-gamma (eIF4G1) are associated with Lewy body dementia. Acta Neuropathol. 2013 Mar;125(3):425-38. doi: 10.1007/s00401-012-1059-4. Epub 2012 Nov 4. PubMed PMID: 23124435; PubMed Central PMCID: PMC3580022.
  • Badura M, Braunstein S, Zavadil J, Schneider RJ. DNA damage and eIF4G1 in breast cancer cells reprogram translation for survival and DNA repair mRNAs. Proc Natl Acad Sci U S A. 2012 Nov 13;109(46):18767-72. doi: 10.1073/pnas.1203853109. Epub 2012 Oct 29. PubMed PMID: 23112151; PubMed Central PMCID: PMC3503184.
  • Zhao Y, Ho P, Prakash KM, Foo JN, Liu JJ, Au WL, Tan LC, Tan EK. Analysis of EIF4G1 in Parkinson's disease among Asians. Neurobiol Aging. 2013 Apr;34(4):1311.e5-6. doi: 10.1016/j.neurobiolaging.2012.09.003. Epub 2012 Oct 23. PubMed PMID: 23092605.
  • Kumar KR, Lohmann K, Klein C. Genetics of Parkinson disease and other movement disorders. Curr Opin Neurol. 2012 Aug;25(4):466-74. doi: 10.1097/WCO.0b013e3283547627. Review. PubMed PMID: 22772876.
  • Schulte EC, Mollenhauer B, Zimprich A, Bereznai B, Lichtner P, Haubenberger D, Pirker W, Brücke T, Molnar MJ, Peters A, Gieger C, Trenkwalder C, Winkelmann J. Variants in eukaryotic translation initiation factor 4G1 in sporadic Parkinson's disease. Neurogenetics. 2012 Aug;13(3):281-5. doi: 10.1007/s10048-012-0334-9. Epub 2012 Jun 16. PubMed PMID: 22707335.
  • Lesage S, Condroyer C, Klebe S, Lohmann E, Durif F, Damier P, Tison F, Anheim M, Honoré A, Viallet F, Bonnet AM, Ouvrard-Hernandez AM, Vidailhet M, Durr A, Brice A; French Parkinson's Disease Genetics Study Group.. EIF4G1 in familial Parkinson's disease: pathogenic mutations or rare benign variants? Neurobiol Aging. 2012 Sep;33(9):2233.e1-2233.e5. doi: 10.1016/j.neurobiolaging.2012.05.006. Epub 2012 Jun 1. PubMed PMID: 22658323.

There are no reviews yet.

Be the first to review “Human eIF4G Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products