Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FLT1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P17948
Molecular weight:
62.57 kDa

Original price was: $372.00.Current price is: $330.00.

50ug 11% OFF + 330 loyalty points
Met1–Val232 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human FLT1 recombinant protein

Human FLT1 recombinant protein

Product name PX-P6533-100
Uniprot ID P17948
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDV
Molecular weight 62.57 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Val232
Aliases /Synonyms Vascular endothelial growth factor receptor 1, VEGFR1, Vascular permeability factor receptor, FRT, Tyrosine-protein kinase receptor FLT, VEGFR-1, FLT, FLT-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1FLT1,
Reference PX-P6533
Molecular Constructor
Met1–Val232 Fc
Product name PX-P6533-1MG
Uniprot ID P17948
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDV
Molecular weight 62.57 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Val232
Aliases /Synonyms Vascular endothelial growth factor receptor 1, VEGFR1, Vascular permeability factor receptor, FRT, Tyrosine-protein kinase receptor FLT, VEGFR-1, FLT, FLT-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1FLT1,
Reference PX-P6533
Molecular Constructor
Met1–Val232 Fc
Product name PX-P6533-50
Uniprot ID P17948
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDV
Molecular weight 62.57 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Val232
Aliases /Synonyms Vascular endothelial growth factor receptor 1, VEGFR1, Vascular permeability factor receptor, FRT, Tyrosine-protein kinase receptor FLT, VEGFR-1, FLT, FLT-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1FLT1,
Reference PX-P6533
Molecular Constructor
Met1–Val232 Fc

There are no reviews yet.

Be the first to review “Human FLT1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products