Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL-3 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P08700
Molecular weight:
16.71 kDa

$392.00

100ug + 392 loyalty points
Ala20–Phe152 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human IL-3 recombinant protein

Product name Human IL-3 recombinant protein
Uniprot ID P08700
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Molecular weight 16.71 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala20-Phe152
Aliases /Synonyms Hematopoietic Growth Factor proteins, IL3, Multipotential colony-stimulating factor, MCGF, Mast cell Growth Factor proteins, Interleukin-3, P-cell-stimulating factor, interleukin 3
Reference PX-P6067
Note For research use only
Molecular Constructor
Ala20–Phe152 His

Human IL-3 recombinant protein

There are no reviews yet.

Be the first to review “Human IL-3 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products