Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL3 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P08700
Molecular weight:
16.70 kDa

Original price was: $318.00.Current price is: $271.00.

50ug 15% OFF + 271 loyalty points
Ala20–Phe152 C-TerminalHis
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human IL3 Recombinant Protein, C-His

Product name ARO-P21302-100
Uniprot ID P08700
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Molecular weight 16.70 kDa
Protein delivered with Tag? C-TerminalHis Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala20-Phe152
Aliases /Synonyms IL3, Hematopoietic growth factor, Multipotential colony-stimulating factor, IL-3, Mast cell growth factor, Interleukin-3, P-cell-stimulating factor, MCGF
Reference ARO-P21302
Note For research use only.
Molecular Constructor
Ala20–Phe152 C-TerminalHis
Product name ARO-P21302-1MG
Uniprot ID P08700
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Molecular weight 16.70 kDa
Protein delivered with Tag? C-TerminalHis Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala20-Phe152
Aliases /Synonyms IL3, Hematopoietic growth factor, Multipotential colony-stimulating factor, IL-3, Mast cell growth factor, Interleukin-3, P-cell-stimulating factor, MCGF
Reference ARO-P21302
Note For research use only.
Molecular Constructor
Ala20–Phe152 C-TerminalHis
Product name ARO-P21302-50
Uniprot ID P08700
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Molecular weight 16.70 kDa
Protein delivered with Tag? C-TerminalHis Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala20-Phe152
Aliases /Synonyms IL3, Hematopoietic growth factor, Multipotential colony-stimulating factor, IL-3, Mast cell growth factor, Interleukin-3, P-cell-stimulating factor, MCGF
Reference ARO-P21302
Note For research use only.
Molecular Constructor
Ala20–Phe152 C-TerminalHis

There are no reviews yet.

Be the first to review “Human IL3 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products