Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IZUMO1R recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
A6ND01
Molecular weight:
26.94 kDa

Original price was: $402.00.Current price is: $330.00.

50ug 18% OFF + 330 loyalty points
Gly20–Ser228 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human IZUMO1R recombinant protein

Human IZUMO1R recombinant protein

Product name PX-P6535-100
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His
Product name PX-P6535-1MG
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His
Product name PX-P6535-50
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His

There are no reviews yet.

Be the first to review “Human IZUMO1R recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products