Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human MICA*027 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
VTZ97898.1
Molecular weight:
26.28 kDa

Original price was: $376.00.Current price is: $330.00.

50ug 12% OFF + 330 loyalty points
Glu24–Ser297 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human MICA*027 recombinant protein

Human MICA*027 recombinant protein

Product name PX-P6568-100
Uniprot ID VTZ97898.1
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS
Molecular weight 26.28 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu24-Ser297
Aliases /Synonyms MIC-A, MHC class I polypeptide-related sequence A, PERB11.1MICA,
Reference PX-P6568
Molecular Constructor
Glu24–Ser297 His
Product name PX-P6568-1MG
Uniprot ID VTZ97898.1
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS
Molecular weight 26.28 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu24-Ser297
Aliases /Synonyms MIC-A, MHC class I polypeptide-related sequence A, PERB11.1MICA,
Reference PX-P6568
Molecular Constructor
Glu24–Ser297 His
Product name PX-P6568-50
Uniprot ID VTZ97898.1
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS
Molecular weight 26.28 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu24-Ser297
Aliases /Synonyms MIC-A, MHC class I polypeptide-related sequence A, PERB11.1MICA,
Reference PX-P6568
Molecular Constructor
Glu24–Ser297 His

There are no reviews yet.

Be the first to review “Human MICA*027 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products