Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human NECTIN4 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q96NY8
Molecular weight:
40.13 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Gly32–Arg144 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human NECTIN4 recombinant protein

Human NECTIN4 recombinant protein

Product name PX-P6525-100
Uniprot ID Q96NY8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLR
Molecular weight 40.13 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly32-Arg144
Aliases /Synonyms NECTIN4, PRR4, Poliovirus receptor-related protein 4, Nectin cell adhesion molecule 4, Ig superfamily receptor LNIR, Nectin-4, PVRL4LNIR,
Reference PX-P6525
Molecular Constructor
Gly32–Arg144 Fc
Product name PX-P6525-1MG
Uniprot ID Q96NY8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLR
Molecular weight 40.13 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly32-Arg144
Aliases /Synonyms NECTIN4, PRR4, Poliovirus receptor-related protein 4, Nectin cell adhesion molecule 4, Ig superfamily receptor LNIR, Nectin-4, PVRL4LNIR,
Reference PX-P6525
Molecular Constructor
Gly32–Arg144 Fc
Product name PX-P6525-50
Uniprot ID Q96NY8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLR
Molecular weight 40.13 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly32-Arg144
Aliases /Synonyms NECTIN4, PRR4, Poliovirus receptor-related protein 4, Nectin cell adhesion molecule 4, Ig superfamily receptor LNIR, Nectin-4, PVRL4LNIR,
Reference PX-P6525
Molecular Constructor
Gly32–Arg144 Fc

There are no reviews yet.

Be the first to review “Human NECTIN4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products