Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human NSMCE2 Recombinant Protein, H-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96MF7

Original price was: $352.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
Ser16–Glu247 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human NSMCE2 Recombinant Protein, H-His

Product name ARO-P18038-100
Uniprot ID Q96MF7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE
Protein delivered with Tag? His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser16-Glu247
Aliases /Synonyms E3 SUMO-protein ligase NSE2, EC:2.3.2.-, E3 SUMO-protein transferase NSE2, MMS21 homolog, hMMS21, Non-structural maintenance of chromosomes element 2 homolog, Non-SMC element 2 homolog, NSMCE2
Reference ARO-P18038
Note For research use only.
Molecular Constructor
Ser16–Glu247 His
Product name ARO-P18038-1MG
Uniprot ID Q96MF7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE
Protein delivered with Tag? His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser16-Glu247
Aliases /Synonyms E3 SUMO-protein ligase NSE2, EC:2.3.2.-, E3 SUMO-protein transferase NSE2, MMS21 homolog, hMMS21, Non-structural maintenance of chromosomes element 2 homolog, Non-SMC element 2 homolog, NSMCE2
Reference ARO-P18038
Note For research use only.
Molecular Constructor
Ser16–Glu247 His
Product name ARO-P18038-50
Uniprot ID Q96MF7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE
Protein delivered with Tag? His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser16-Glu247
Aliases /Synonyms E3 SUMO-protein ligase NSE2, EC:2.3.2.-, E3 SUMO-protein transferase NSE2, MMS21 homolog, hMMS21, Non-structural maintenance of chromosomes element 2 homolog, Non-SMC element 2 homolog, NSMCE2
Reference ARO-P18038
Note For research use only.
Molecular Constructor
Ser16–Glu247 His

There are no reviews yet.

Be the first to review “Human NSMCE2 Recombinant Protein, H-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products