Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human SLC22A18 Recombinant Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96BI1
Molecular weight:
16.74 kDa

Original price was: $352.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
His-SUMO Thr200–Arg242
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human SLC22A18 Recombinant Protein, N-His-SUMO

Product name ARO-P19524-100
Uniprot ID Q96BI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TCIPASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPR
Molecular weight 16.74 kDa
Protein delivered with Tag? N-Terminal His-SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr200-Arg242
Aliases /Synonyms BWR1A, BWSCR1A, Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein, Efflux transporter-like protein, HET, IMPT1, ITM, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, ORCTL-2, ORCTL2, Organic cation transporter-like protein 2, SLC22A18, SLC22A1L, SLC67A1, Solute carrier family 22 member 1-like, Solute carrier family 22 member 18, Solute carrier family 67 member A1, TSSC5, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein, p45-BWR1A, p45-Beckwith-Wiedemann region 1 A
Reference ARO-P19524
Note For research use only.
Molecular Constructor
His-SUMO Thr200–Arg242
Product name ARO-P19524-1MG
Uniprot ID Q96BI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TCIPASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPR
Molecular weight 16.74 kDa
Protein delivered with Tag? N-Terminal His-SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr200-Arg242
Aliases /Synonyms BWR1A, BWSCR1A, Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein, Efflux transporter-like protein, HET, IMPT1, ITM, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, ORCTL-2, ORCTL2, Organic cation transporter-like protein 2, SLC22A18, SLC22A1L, SLC67A1, Solute carrier family 22 member 1-like, Solute carrier family 22 member 18, Solute carrier family 67 member A1, TSSC5, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein, p45-BWR1A, p45-Beckwith-Wiedemann region 1 A
Reference ARO-P19524
Note For research use only.
Molecular Constructor
His-SUMO Thr200–Arg242
Product name ARO-P19524-50
Uniprot ID Q96BI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TCIPASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPR
Molecular weight 16.74 kDa
Protein delivered with Tag? N-Terminal His-SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr200-Arg242
Aliases /Synonyms BWR1A, BWSCR1A, Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein, Efflux transporter-like protein, HET, IMPT1, ITM, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, ORCTL-2, ORCTL2, Organic cation transporter-like protein 2, SLC22A18, SLC22A1L, SLC67A1, Solute carrier family 22 member 1-like, Solute carrier family 22 member 18, Solute carrier family 67 member A1, TSSC5, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein, p45-BWR1A, p45-Beckwith-Wiedemann region 1 A
Reference ARO-P19524
Note For research use only.
Molecular Constructor
His-SUMO Thr200–Arg242

There are no reviews yet.

Be the first to review “Human SLC22A18 Recombinant Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products