Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TCF7L2 Recombinant Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NQB0
Molecular weight:
22.10 kDa

Original price was: $350.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
His-SUMO Asn355–Lys425 Strep
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TCF7L2 Recombinant Protein, N-His-SUMO & C-Strep

Product name ARO-P19283-100
Uniprot ID Q9NQB0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGK
Molecular weight 22.10 kDa
Protein delivered with Tag? N-Terminal His-SUMO and C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn355-Lys425
Aliases /Synonyms HMG box transcription factor 4, T-cell factor 4, T-cell-specific transcription factor 4, TCF-4, TCF4, TCF7L2, Transcription factor 7-like 2, hTCF-4
Reference ARO-P19283
Note For research use only.
Molecular Constructor
His-SUMO Asn355–Lys425 Strep
Product name ARO-P19283-1MG
Uniprot ID Q9NQB0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGK
Molecular weight 22.10 kDa
Protein delivered with Tag? N-Terminal His-SUMO and C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn355-Lys425
Aliases /Synonyms HMG box transcription factor 4, T-cell factor 4, T-cell-specific transcription factor 4, TCF-4, TCF4, TCF7L2, Transcription factor 7-like 2, hTCF-4
Reference ARO-P19283
Note For research use only.
Molecular Constructor
His-SUMO Asn355–Lys425 Strep
Product name ARO-P19283-50
Uniprot ID Q9NQB0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGK
Molecular weight 22.10 kDa
Protein delivered with Tag? N-Terminal His-SUMO and C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn355-Lys425
Aliases /Synonyms HMG box transcription factor 4, T-cell factor 4, T-cell-specific transcription factor 4, TCF-4, TCF4, TCF7L2, Transcription factor 7-like 2, hTCF-4
Reference ARO-P19283
Note For research use only.
Molecular Constructor
His-SUMO Asn355–Lys425 Strep

There are no reviews yet.

Be the first to review “Human TCF7L2 Recombinant Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products