Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TCR β Monoclonal Antibody

Original price was: $487.00.Current price is: $393.00.

100ug 19% OFF + 393 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TCR β Monoclonal Antibody

Product name ARO-A16161-100
Uniprot ID P01733
Uniprot link P01733
Raw Antigen Sequence MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms T-cell receptor beta chain V region YT35, TCRBV8S1, TCRBV12S3, T cell receptor beta variable 12-3, TRBV12-3
Reference ARO-A16161
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR β
Clone Name IARC307
Protein Name TCR β
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16161-1MG
Uniprot ID P01733
Uniprot link P01733
Raw Antigen Sequence MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms T-cell receptor beta chain V region YT35, TCRBV8S1, TCRBV12S3, T cell receptor beta variable 12-3, TRBV12-3
Reference ARO-A16161
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR β
Clone Name IARC307
Protein Name TCR β
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16161-50
Uniprot ID P01733
Uniprot link P01733
Raw Antigen Sequence MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms T-cell receptor beta chain V region YT35, TCRBV8S1, TCRBV12S3, T cell receptor beta variable 12-3, TRBV12-3
Reference ARO-A16161
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TCR β
Clone Name IARC307
Protein Name TCR β
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human TCR β Monoclonal Antibody

SDS-PAGE for Human TCR β Monoclonal Antibody

Human TCR β Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human TCR β Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human TCR β Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products