Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TGFBR1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P36897
Molecular weight:
38.42 kDa

Original price was: $408.00.Current price is: $330.00.

50ug 19% OFF + 330 loyalty points
Leu34–Leu126 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human TGFBR1 recombinant protein

Human TGFBR1 recombinant protein

Product name PX-P6523-100
Uniprot ID P36897
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL
Molecular weight 38.42 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu34-Leu126
Aliases /Synonyms ALK-5, TGFBR1, TGFR-1, ALK5, Transforming growth factor-beta receptor type I, TGF-beta type I receptor, TbetaR-I, SKR4, Activin A receptor type II-like protein kinase of 53kD, TGF-beta receptor type I, TGF-beta receptor type-1, Serine/threonine-protein kinase receptor R4Activin receptor-like kinase 5,
Reference PX-P6523
Molecular Constructor
Leu34–Leu126 Fc
Product name PX-P6523-1MG
Uniprot ID P36897
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL
Molecular weight 38.42 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu34-Leu126
Aliases /Synonyms ALK-5, TGFBR1, TGFR-1, ALK5, Transforming growth factor-beta receptor type I, TGF-beta type I receptor, TbetaR-I, SKR4, Activin A receptor type II-like protein kinase of 53kD, TGF-beta receptor type I, TGF-beta receptor type-1, Serine/threonine-protein kinase receptor R4Activin receptor-like kinase 5,
Reference PX-P6523
Molecular Constructor
Leu34–Leu126 Fc
Product name PX-P6523-50
Uniprot ID P36897
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL
Molecular weight 38.42 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu34-Leu126
Aliases /Synonyms ALK-5, TGFBR1, TGFR-1, ALK5, Transforming growth factor-beta receptor type I, TGF-beta type I receptor, TbetaR-I, SKR4, Activin A receptor type II-like protein kinase of 53kD, TGF-beta receptor type I, TGF-beta receptor type-1, Serine/threonine-protein kinase receptor R4Activin receptor-like kinase 5,
Reference PX-P6523
Molecular Constructor
Leu34–Leu126 Fc

There are no reviews yet.

Be the first to review “Human TGFBR1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products