Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human TNFa Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human TNFa Recombinant Protein |
|---|---|
| Uniprot ID | P01375 |
| Uniprot link | http://www.uniprot.org/uniprot/P01375 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Molecular weight | 18.56 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS,pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| NCBI Reference | P01375 |
| Aliases /Synonyms | DIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa, cachexin |
| Reference | PX-P3058 |
| Note | For research use only. |
Related products
Biosimilar
Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1219 238$
Biosimilar
Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1272 238$
Biosimilar
Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1362 238$
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.