Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human WFDC2/WAP5/HE4 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q14508

Original price was: $426.00.Current price is: $387.00.

100ug 9% OFF + 387 loyalty points
Glu31–Phe124 Fc
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human WFDC2/WAP5/HE4 Recombinant Protein, C-Fc

Human WFDC2/WAP5/HE4 Recombinant Protein, C-Fc

Product name ARO-P18954-100
Uniprot ID Q14508
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu31-Phe124
Aliases /Synonyms Epididymal secretory protein E4, HE4, Isoform 1 of WAP four-disulfide core domain protein 2, Major epididymis-specific protein E4, Putative protease inhibitor WAP5, WAP5, WFDC2
Reference ARO-P18954
Note For research use only.
Molecular Constructor
Glu31–Phe124 Fc
Product name ARO-P18954-1MG
Uniprot ID Q14508
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu31-Phe124
Aliases /Synonyms Epididymal secretory protein E4, HE4, Isoform 1 of WAP four-disulfide core domain protein 2, Major epididymis-specific protein E4, Putative protease inhibitor WAP5, WAP5, WFDC2
Reference ARO-P18954
Note For research use only.
Molecular Constructor
Glu31–Phe124 Fc
Product name ARO-P18954-50
Uniprot ID Q14508
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu31-Phe124
Aliases /Synonyms Epididymal secretory protein E4, HE4, Isoform 1 of WAP four-disulfide core domain protein 2, Major epididymis-specific protein E4, Putative protease inhibitor WAP5, WAP5, WFDC2
Reference ARO-P18954
Note For research use only.
Molecular Constructor
Glu31–Phe124 Fc

There are no reviews yet.

Be the first to review “Human WFDC2/WAP5/HE4 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products