Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human XIAP Recombinant Protein, N-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P98170

Original price was: $352.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
His Asn252–Thr356
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human XIAP Recombinant Protein, N-His

Product name ARO-P17773-100
Uniprot ID P98170
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence NSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn252-Thr356
Aliases /Synonyms E3 ubiquitin-protein ligase XIAP, 2.3.2.27, Baculoviral IAP repeat-containing protein 4, IAP-like protein, ILP, hILP, Inhibitor of apoptosis protein 3, IAP-3, hIAP-3, hIAP3, RING-type E3 ubiquitin transferase XIAP, X-linked inhibitor of apoptosis protein, X-linked IAP, XIAP, API3, BIRC4, IAP3
Reference ARO-P17773
Note For research use only.
Molecular Constructor
His Asn252–Thr356
Product name ARO-P17773-1MG
Uniprot ID P98170
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence NSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn252-Thr356
Aliases /Synonyms E3 ubiquitin-protein ligase XIAP, 2.3.2.27, Baculoviral IAP repeat-containing protein 4, IAP-like protein, ILP, hILP, Inhibitor of apoptosis protein 3, IAP-3, hIAP-3, hIAP3, RING-type E3 ubiquitin transferase XIAP, X-linked inhibitor of apoptosis protein, X-linked IAP, XIAP, API3, BIRC4, IAP3
Reference ARO-P17773
Note For research use only.
Molecular Constructor
His Asn252–Thr356
Product name ARO-P17773-50
Uniprot ID P98170
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence NSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn252-Thr356
Aliases /Synonyms E3 ubiquitin-protein ligase XIAP, 2.3.2.27, Baculoviral IAP repeat-containing protein 4, IAP-like protein, ILP, hILP, Inhibitor of apoptosis protein 3, IAP-3, hIAP-3, hIAP3, RING-type E3 ubiquitin transferase XIAP, X-linked inhibitor of apoptosis protein, X-linked IAP, XIAP, API3, BIRC4, IAP3
Reference ARO-P17773
Note For research use only.
Molecular Constructor
His Asn252–Thr356

There are no reviews yet.

Be the first to review “Human XIAP Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products