Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ZRSR2 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15696
Molecular weight:
39.36 kDa

Original price was: $301.00.Current price is: $271.00.

50ug 10% OFF + 271 loyalty points
His Ala170–Lys482
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ZRSR2 Recombinant Protein, N-His

Product name ARO-P20039-100
Uniprot ID Q15696
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
Molecular weight 39.36 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala170-Lys482
Aliases /Synonyms CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2, Renal carcinoma antigen NY-REN-20, U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2, U2(RNU2) small nuclear RNA auxiliary factor 1-like 2, U2AF1-RS2, U2AF1L2, U2AF1RS2, U2AF35-related protein, URP, ZRSR2
Reference ARO-P20039
Note For research use only.
Molecular Constructor
His Ala170–Lys482
Product name ARO-P20039-1MG
Uniprot ID Q15696
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
Molecular weight 39.36 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala170-Lys482
Aliases /Synonyms CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2, Renal carcinoma antigen NY-REN-20, U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2, U2(RNU2) small nuclear RNA auxiliary factor 1-like 2, U2AF1-RS2, U2AF1L2, U2AF1RS2, U2AF35-related protein, URP, ZRSR2
Reference ARO-P20039
Note For research use only.
Molecular Constructor
His Ala170–Lys482
Product name ARO-P20039-50
Uniprot ID Q15696
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
Molecular weight 39.36 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala170-Lys482
Aliases /Synonyms CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2, Renal carcinoma antigen NY-REN-20, U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2, U2(RNU2) small nuclear RNA auxiliary factor 1-like 2, U2AF1-RS2, U2AF1L2, U2AF1RS2, U2AF35-related protein, URP, ZRSR2
Reference ARO-P20039
Note For research use only.
Molecular Constructor
His Ala170–Lys482

There are no reviews yet.

Be the first to review “Human ZRSR2 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products