Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-1 alpha(IL1A)His Tag

Host species:
Mammalian cells
Uniprot ID:
P01583
Molecular weight:
21.3kDa

$250.00

50ug + 250 loyalty points
Ser113–Ala271 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-1 alpha(IL1A)His Tag

Product name Interleukin-1 alpha(IL1A)His Tag
Uniprot ID P01583
Uniprot link https://www.uniprot.org/uniprot/P01583
Expression system Eukaryotic expression
Raw Antigen Sequence MKHLWFFLLLVAAPRWVLSSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQAGSHHHHHH
Molecular weight 21.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser113-Ala271
Protein Accession P01583
Spec:Entrez GeneID 3552
Spec:NCBI Gene Aliases IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha
Spec:SwissProtID Q53QF9
NCBI Reference P01583
Aliases /Synonyms IL-1 alpha,Hematopoietin-1,IL1F1
Reference PX-P4854
Note For research use only
Molecular Constructor
Ser113–Ala271 His
Product name Interleukin-1 alpha(IL1A)His Tag
Uniprot ID P01583
Uniprot link https://www.uniprot.org/uniprot/P01583
Expression system Eukaryotic expression
Raw Antigen Sequence MKHLWFFLLLVAAPRWVLSSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQAGSHHHHHH
Molecular weight 21.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser113-Ala271
Protein Accession P01583
Spec:Entrez GeneID 3552
Spec:NCBI Gene Aliases IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha
Spec:SwissProtID Q53QF9
NCBI Reference P01583
Aliases /Synonyms IL-1 alpha,Hematopoietin-1,IL1F1
Reference PX-P4854
Note For research use only
Molecular Constructor
Ser113–Ala271 His

There are no reviews yet.

Be the first to review “Interleukin-1 alpha(IL1A)His Tag”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products