Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Interleukin-1 receptor antagonist protein(IL1RN)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P18510
Molecular weight:
18kDa

$217.00

+ 217 loyalty points
Arg26–Glu177 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Interferon-induced helicase C domain-containing protein 1 (IFIH1)

Interleukin-1 receptor antagonist protein(IL1RN)

Product name Interleukin-1 receptor antagonist protein(IL1RN)
Uniprot ID P18510
Uniprot link https://www.uniprot.org/uniprot/P18510#P18510
Expression system Prokaryotic expression
Sequence RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDEGSHHHHHH
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Bacillus subtilis
Fragment Type Arg26-Glu177
Protein Accession P18510
Spec:Entrez GeneID 3557
Spec:NCBI Gene Aliases DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Spec:SwissProtID Q14628
NCBI Reference P18510
Aliases /Synonyms IL-1RN,IL-1ra,IRAP,ICIL-1RA,IL1 inhibitor,INN: Anakinra,IL1F3, IL1RA
Reference PX-P4651
Note For research use only
Molecular Constructor
Arg26–Glu177 His
Product name Interleukin-1 receptor antagonist protein(IL1RN)
Uniprot ID P18510
Uniprot link https://www.uniprot.org/uniprot/P18510#P18510
Expression system Prokaryotic expression
Sequence RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDEGSHHHHHH
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Bacillus subtilis
Fragment Type Arg26-Glu177
Protein Accession P18510
Spec:Entrez GeneID 3557
Spec:NCBI Gene Aliases DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Spec:SwissProtID Q14628
NCBI Reference P18510
Aliases /Synonyms IL-1RN,IL-1ra,IRAP,ICIL-1RA,IL1 inhibitor,INN: Anakinra,IL1F3, IL1RA
Reference PX-P4651
Note For research use only
Molecular Constructor
Arg26–Glu177 His

SDS-PAGE for Interferon-induced helicase C domain-containing protein 1 (IFIH1)

SDS-PAGE for Interferon-induced helicase C domain-containing protein 1 (IFIH1)

Interferon-induced helicase C domain-containing protein 1 (IFIH1) on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %

There are no reviews yet.

Be the first to review “Interleukin-1 receptor antagonist protein(IL1RN)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products