Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Mouse TIGIT Antibody (1B4)

Clonality:
Monoclonal Antibody
Host species:
Mouse

Original price was: $412.00.Current price is: $305.00.

50ug 26% OFF + 305 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Mouse TIGIT Antibody (1B4)

Product name ARO-A12971-100
Uniprot ID P86176
Raw Antigen Sequence MHGWLLLVWVQGLIQAAFLATAIGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKDKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-T-cell immunoreceptor with Ig and ITIM domains, V-set and transmembrane domain-containing protein 3, Tigit, Vstm3
Reference ARO-A12971
Clonality Monoclonal Antibody
Protein Name T-cell immunoreceptor with Ig and ITIM domains
Product name ARO-A12971-1MG
Uniprot ID P86176
Raw Antigen Sequence MHGWLLLVWVQGLIQAAFLATAIGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKDKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-T-cell immunoreceptor with Ig and ITIM domains, V-set and transmembrane domain-containing protein 3, Tigit, Vstm3
Reference ARO-A12971
Clonality Monoclonal Antibody
Protein Name T-cell immunoreceptor with Ig and ITIM domains
Product name ARO-A12971-50
Uniprot ID P86176
Raw Antigen Sequence MHGWLLLVWVQGLIQAAFLATAIGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKDKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-T-cell immunoreceptor with Ig and ITIM domains, V-set and transmembrane domain-containing protein 3, Tigit, Vstm3
Reference ARO-A12971
Clonality Monoclonal Antibody
Protein Name T-cell immunoreceptor with Ig and ITIM domains

SDS-PAGE for InVivoMAb Anti-Mouse TIGIT Antibody (1B4)

SDS-PAGE for InVivoMAb Anti-Mouse TIGIT Antibody (1B4)

InVivoMAb Anti-Mouse TIGIT Antibody (1B4), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Mouse TIGIT Antibody (1B4)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products