Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Staphylococcus aureus LukF (Iv0100)

Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $405.00.Current price is: $305.00.

50ug 25% OFF + 305 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Staphylococcus aureus LukF (Iv0100)

Product name ARO-A13272-100
Uniprot ID P31715
Raw Antigen Sequence MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Leukocidin-F subunit, Gamma-hemolysin, H-gamma-I subunit, lukF
Reference ARO-A13272
Clonality Monoclonal Antibody
Protein Name Leukocidin-F subunit
Product name ARO-A13272-1MG
Uniprot ID P31715
Raw Antigen Sequence MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Leukocidin-F subunit, Gamma-hemolysin, H-gamma-I subunit, lukF
Reference ARO-A13272
Clonality Monoclonal Antibody
Protein Name Leukocidin-F subunit
Product name ARO-A13272-50
Uniprot ID P31715
Raw Antigen Sequence MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Leukocidin-F subunit, Gamma-hemolysin, H-gamma-I subunit, lukF
Reference ARO-A13272
Clonality Monoclonal Antibody
Protein Name Leukocidin-F subunit

SDS-PAGE for InVivoMAb Anti-Staphylococcus aureus LukF (Iv0100)

SDS-PAGE for InVivoMAb Anti-Staphylococcus aureus LukF (Iv0100)

InVivoMAb Anti-Staphylococcus aureus LukF (Iv0100), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Staphylococcus aureus LukF (Iv0100)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products