Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

ITGAL recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P20701
Molecular weight:
31.16 kDa

Original price was: $339.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
His Asn809–His1066
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

ITGAL recombinant protein

Product name PX-P5176-100
Uniprot ID P20701
Uniprot link https://www.uniprot.org/uniprot/P20701
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFH
Molecular weight 31.16 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn809-His1066
Protein Accession P20701
Aliases /Synonyms CD11A, Leukocyte function-associated molecule 1 alpha chain, Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, CD11 antigen-like family member A, CD11a, Integrin alpha-L
Reference PX-P5176
Note For research use only
Molecular Constructor
His Asn809–His1066
Product name PX-P5176-1MG
Uniprot ID P20701
Uniprot link https://www.uniprot.org/uniprot/P20701
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFH
Molecular weight 31.16 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn809-His1066
Protein Accession P20701
Aliases /Synonyms CD11A, Leukocyte function-associated molecule 1 alpha chain, Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, CD11 antigen-like family member A, CD11a, Integrin alpha-L
Reference PX-P5176
Note For research use only
Molecular Constructor
His Asn809–His1066
Product name PX-P5176-50
Uniprot ID P20701
Uniprot link https://www.uniprot.org/uniprot/P20701
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFH
Molecular weight 31.16 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn809-His1066
Protein Accession P20701
Aliases /Synonyms CD11A, Leukocyte function-associated molecule 1 alpha chain, Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, CD11 antigen-like family member A, CD11a, Integrin alpha-L
Reference PX-P5176
Note For research use only
Molecular Constructor
His Asn809–His1066

SDS-PAGE for ITGAL recombinant protein

SDS-PAGE for ITGAL recombinant protein

ITGAL recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

ITGAL recombinant protein

There are no reviews yet.

Be the first to review “ITGAL recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products