Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

LIV prM Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Louping ill virus (LIV)
Uniprot ID:
P22338

Original price was: $309.00.Current price is: $271.00.

50ug 12% OFF + 271 loyalty points
GST Thr118–Arg205 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

LIV prM Recombinant Protein, N-GST & C-His

Product name ARO-P18724-100
Uniprot ID P22338
Origin species Louping ill virus (LIV)
Expression system Prokaryotic expression
Raw Antigen Sequence TVRKEGDGTTVIRAEGRDAATQVRVENGTCVILATDMGSWCDDSLSYECVTIEQGEEPVDVDCFCRNVDGVYLEYGRCGKQEGSRTRR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr118-Arg205
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5
Reference ARO-P18724
Note For research use only.
Molecular Constructor
GST Thr118–Arg205 His
Product name ARO-P18724-1MG
Uniprot ID P22338
Origin species Louping ill virus (LIV)
Expression system Prokaryotic expression
Raw Antigen Sequence TVRKEGDGTTVIRAEGRDAATQVRVENGTCVILATDMGSWCDDSLSYECVTIEQGEEPVDVDCFCRNVDGVYLEYGRCGKQEGSRTRR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr118-Arg205
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5
Reference ARO-P18724
Note For research use only.
Molecular Constructor
GST Thr118–Arg205 His
Product name ARO-P18724-50
Uniprot ID P22338
Origin species Louping ill virus (LIV)
Expression system Prokaryotic expression
Raw Antigen Sequence TVRKEGDGTTVIRAEGRDAATQVRVENGTCVILATDMGSWCDDSLSYECVTIEQGEEPVDVDCFCRNVDGVYLEYGRCGKQEGSRTRR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr118-Arg205
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5
Reference ARO-P18724
Note For research use only.
Molecular Constructor
GST Thr118–Arg205 His

There are no reviews yet.

Be the first to review “LIV prM Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products