Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CASP9/Caspase 9 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8C3Q9

Original price was: $350.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
Asp196–Ser454
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CASP9/Caspase 9 Recombinant Protein

Product name ARO-P18431-100
Uniprot ID Q8C3Q9
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp196-Ser454
Aliases /Synonyms Caspase-9, CASP-9, EC:3.4.22.62, Apoptotic protease Mch-6, Apoptotic protease-activating factor 3, APAF-3, ICE-like apoptotic protease 6, ICE-LAP6, Caspase-9 subunit p35, Caspase-9 subunit p10, Casp9, Mch6
Reference ARO-P18431
Note For research use only.
Molecular Constructor
Asp196–Ser454
Product name ARO-P18431-1MG
Uniprot ID Q8C3Q9
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp196-Ser454
Aliases /Synonyms Caspase-9, CASP-9, EC:3.4.22.62, Apoptotic protease Mch-6, Apoptotic protease-activating factor 3, APAF-3, ICE-like apoptotic protease 6, ICE-LAP6, Caspase-9 subunit p35, Caspase-9 subunit p10, Casp9, Mch6
Reference ARO-P18431
Note For research use only.
Molecular Constructor
Asp196–Ser454
Product name ARO-P18431-50
Uniprot ID Q8C3Q9
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp196-Ser454
Aliases /Synonyms Caspase-9, CASP-9, EC:3.4.22.62, Apoptotic protease Mch-6, Apoptotic protease-activating factor 3, APAF-3, ICE-like apoptotic protease 6, ICE-LAP6, Caspase-9 subunit p35, Caspase-9 subunit p10, Casp9, Mch6
Reference ARO-P18431
Note For research use only.
Molecular Constructor
Asp196–Ser454

There are no reviews yet.

Be the first to review “Mouse CASP9/Caspase 9 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products