Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD121a/IL1R1 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P13504

Original price was: $337.00.Current price is: $271.00.

50ug 20% OFF + 271 loyalty points
His Leu20–Val334
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CD121a/IL1R1 Recombinant Protein, N-His

Product name ARO-P18345-100
Uniprot ID P13504
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPV
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu20-Val334
Aliases /Synonyms Interleukin-1 receptor type 1; IL-1R-1; IL-1RT-1; IL-1RT1; 3.2.2.6; CD121 antigen-like family member A; Interleukin-1 receptor alpha; IL-1R-alpha; Interleukin-1 receptor type I; p80; CD121a; Interleukin-1 receptor type 1, membrane form; mIL-1R1; mIL-1RI; Interleukin-1 receptor type 1, soluble form; sIL-1R1; sIL-1RI; Il1r1; Il-1r1; Il1ra
Reference ARO-P18345
Note For research use only.
Molecular Constructor
His Leu20–Val334
Product name ARO-P18345-1MG
Uniprot ID P13504
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPV
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu20-Val334
Aliases /Synonyms Interleukin-1 receptor type 1; IL-1R-1; IL-1RT-1; IL-1RT1; 3.2.2.6; CD121 antigen-like family member A; Interleukin-1 receptor alpha; IL-1R-alpha; Interleukin-1 receptor type I; p80; CD121a; Interleukin-1 receptor type 1, membrane form; mIL-1R1; mIL-1RI; Interleukin-1 receptor type 1, soluble form; sIL-1R1; sIL-1RI; Il1r1; Il-1r1; Il1ra
Reference ARO-P18345
Note For research use only.
Molecular Constructor
His Leu20–Val334
Product name ARO-P18345-50
Uniprot ID P13504
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPV
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu20-Val334
Aliases /Synonyms Interleukin-1 receptor type 1; IL-1R-1; IL-1RT-1; IL-1RT1; 3.2.2.6; CD121 antigen-like family member A; Interleukin-1 receptor alpha; IL-1R-alpha; Interleukin-1 receptor type I; p80; CD121a; Interleukin-1 receptor type 1, membrane form; mIL-1R1; mIL-1RI; Interleukin-1 receptor type 1, soluble form; sIL-1R1; sIL-1RI; Il1r1; Il-1r1; Il1ra
Reference ARO-P18345
Note For research use only.
Molecular Constructor
His Leu20–Val334

There are no reviews yet.

Be the first to review “Mouse CD121a/IL1R1 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products