Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CXCL13/BCA-1/BLC Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
O55038

Original price was: $331.00.Current price is: $271.00.

50ug 18% OFF + 271 loyalty points
His Ile22–Ala109
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CXCL13/BCA-1/BLC Recombinant Protein, N-His

Product name ARO-P17786-100
Uniprot ID O55038
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Ala109
Aliases /Synonyms C-X-C motif chemokine 13, Angie, B cell-attracting chemokine 1, BCA-1, B lymphocyte chemoattractant, CXC chemokine BLC, Small-inducible cytokine B13, CXCL13
Reference ARO-P17786
Note For research use only.
Molecular Constructor
His Ile22–Ala109
Product name ARO-P17786-1MG
Uniprot ID O55038
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Ala109
Aliases /Synonyms C-X-C motif chemokine 13, Angie, B cell-attracting chemokine 1, BCA-1, B lymphocyte chemoattractant, CXC chemokine BLC, Small-inducible cytokine B13, CXCL13
Reference ARO-P17786
Note For research use only.
Molecular Constructor
His Ile22–Ala109
Product name ARO-P17786-50
Uniprot ID O55038
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Ala109
Aliases /Synonyms C-X-C motif chemokine 13, Angie, B cell-attracting chemokine 1, BCA-1, B lymphocyte chemoattractant, CXC chemokine BLC, Small-inducible cytokine B13, CXCL13
Reference ARO-P17786
Note For research use only.
Molecular Constructor
His Ile22–Ala109

There are no reviews yet.

Be the first to review “Mouse CXCL13/BCA-1/BLC Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products