Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse EXTL2 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q9ES89
Molecular weight:
35.72 kDa

Original price was: $433.00.Current price is: $387.00.

100ug 11% OFF + 387 loyalty points
Asn43–Met330 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse EXTL2 Recombinant Protein, C-His

Product name ARO-P18988-100
Uniprot ID Q9ES89
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
Molecular weight 35.72 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn43-Met330
Aliases /Synonyms Alpha-1,4-N-acetylhexosaminyltransferase EXTL2, Alpha-GalNAcT EXTL2, EC:2.4.1.223, EXT-related protein 2, EXTL2, EXTR2, Exostosin-like 2, Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, Processed exostosin-like 2
Reference ARO-P18988
Note For research use only.
Molecular Constructor
Asn43–Met330 His
Product name ARO-P18988-1MG
Uniprot ID Q9ES89
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
Molecular weight 35.72 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn43-Met330
Aliases /Synonyms Alpha-1,4-N-acetylhexosaminyltransferase EXTL2, Alpha-GalNAcT EXTL2, EC:2.4.1.223, EXT-related protein 2, EXTL2, EXTR2, Exostosin-like 2, Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, Processed exostosin-like 2
Reference ARO-P18988
Note For research use only.
Molecular Constructor
Asn43–Met330 His
Product name ARO-P18988-50
Uniprot ID Q9ES89
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
Molecular weight 35.72 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn43-Met330
Aliases /Synonyms Alpha-1,4-N-acetylhexosaminyltransferase EXTL2, Alpha-GalNAcT EXTL2, EC:2.4.1.223, EXT-related protein 2, EXTL2, EXTR2, Exostosin-like 2, Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, Processed exostosin-like 2
Reference ARO-P18988
Note For research use only.
Molecular Constructor
Asn43–Met330 His

There are no reviews yet.

Be the first to review “Mouse EXTL2 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products