Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse RARRES2 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q9DD06
Molecular weight:
18.59 kDa

Original price was: $445.00.Current price is: $387.00.

100ug 13% OFF + 387 loyalty points
Met1–Ser156 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse RARRES2 Recombinant Protein, C-His

Product name ARO-P20869-100
Uniprot ID Q9DD06
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS
Molecular weight 18.59 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser156
Aliases /Synonyms Chemerin, RAR-responsive protein TIG2, RARRES2, Retinoic acid receptor responder protein 2, TIG2, Tazarotene-induced gene 2 protein
Reference ARO-P20869
Note For research use only.
Molecular Constructor
Met1–Ser156 His
Product name ARO-P20869-1MG
Uniprot ID Q9DD06
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS
Molecular weight 18.59 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser156
Aliases /Synonyms Chemerin, RAR-responsive protein TIG2, RARRES2, Retinoic acid receptor responder protein 2, TIG2, Tazarotene-induced gene 2 protein
Reference ARO-P20869
Note For research use only.
Molecular Constructor
Met1–Ser156 His
Product name ARO-P20869-50
Uniprot ID Q9DD06
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS
Molecular weight 18.59 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser156
Aliases /Synonyms Chemerin, RAR-responsive protein TIG2, RARRES2, Retinoic acid receptor responder protein 2, TIG2, Tazarotene-induced gene 2 protein
Reference ARO-P20869
Note For research use only.
Molecular Constructor
Met1–Ser156 His

There are no reviews yet.

Be the first to review “Mouse RARRES2 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products