Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse Serpina1a Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P07758
Molecular weight:
72.40 kDa

Original price was: $318.00.Current price is: $271.00.

50ug 15% OFF + 271 loyalty points
Met1–Lys413 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse Serpina1a Recombinant Protein, C-Fc

Product name ARO-P20279-100
Uniprot ID P07758
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK
Molecular weight 72.40 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys413
Aliases /Synonyms AAT, Alpha-1 protease inhibitor 1, Alpha-1-antiproteinase, Alpha-1-antitrypsin 1-1, Dom1, Serine protease inhibitor 1-1, Serine protease inhibitor A1a, Serpin A1a, Serpina1a, Spi1-1
Reference ARO-P20279
Note For research use only.
Molecular Constructor
Met1–Lys413 Fc
Product name ARO-P20279-1MG
Uniprot ID P07758
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK
Molecular weight 72.40 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys413
Aliases /Synonyms AAT, Alpha-1 protease inhibitor 1, Alpha-1-antiproteinase, Alpha-1-antitrypsin 1-1, Dom1, Serine protease inhibitor 1-1, Serine protease inhibitor A1a, Serpin A1a, Serpina1a, Spi1-1
Reference ARO-P20279
Note For research use only.
Molecular Constructor
Met1–Lys413 Fc
Product name ARO-P20279-50
Uniprot ID P07758
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK
Molecular weight 72.40 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys413
Aliases /Synonyms AAT, Alpha-1 protease inhibitor 1, Alpha-1-antiproteinase, Alpha-1-antitrypsin 1-1, Dom1, Serine protease inhibitor 1-1, Serine protease inhibitor A1a, Serpin A1a, Serpina1a, Spi1-1
Reference ARO-P20279
Note For research use only.
Molecular Constructor
Met1–Lys413 Fc

There are no reviews yet.

Be the first to review “Mouse Serpina1a Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products