Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Muromonab-Cd3 Biosimilar – Anti-CD3E mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: $428.00.Current price is: $308.00.

50ug 28% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade

Product name Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 140608-64-6
Species Mus musculus
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Muromonab-Cd3,OKT3,CD3E,anti-CD3E
Reference PX-TA1092
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-kappa
Clonality Monoclonal Antibody
Product name Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 140608-64-6
Species Mus musculus
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Muromonab-Cd3,OKT3,CD3E,anti-CD3E
Reference PX-TA1092
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-kappa
Clonality Monoclonal Antibody
Product name PX-TA1092-50
Uniprot ID P07766
Source CAS 140608-64-6
Species Mus musculus
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Muromonab-Cd3,OKT3,CD3E,anti-CD3E
Reference PX-TA1092
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody

Introduction

Muromonab-Cd3 Biosimilar, also known as Anti-CD3E mAb, is a monoclonal antibody that targets the CD3E protein. It is a research grade antibody that has been developed as a biosimilar to the original Muromonab-Cd3 antibody, which was the first monoclonal antibody approved by the FDA for clinical use. In this article, we will discuss the structure, activity, and potential applications of this biosimilar antibody.

Structure

Muromonab-Cd3 Biosimilar is a recombinant, humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, linked by disulfide bonds. The antibody has a variable region that specifically binds to the CD3E protein, and a constant region that mediates its effector functions.

Activity

The main function of Muromonab-Cd3 Biosimilar is to bind to the CD3E protein, which is a component of the T-cell receptor complex. This binding leads to the activation of T-cells, which play a crucial role in the immune response. Activation of T-cells by Muromonab-Cd3 Biosimilar results in the production of cytokines, such as interleukin-2, which can enhance the immune response against cancer cells or pathogens.

In addition to its role in T-cell activation, Muromonab-Cd3 Biosimilar also has immunosuppressive effects. It can bind to and deplete CD3E-positive T-cells, which are involved in autoimmune diseases. This mechanism of action has been used in the treatment of autoimmune disorders, such as type 1 diabetes and multiple sclerosis.

Applications

Muromonab-Cd3 Biosimilar has various potential applications in both research and clinical settings. In research, it can be used as a tool to study T-cell activation and function. It can also be used in in vitro assays to screen for potential immunomodulatory drugs.

In the clinical setting, Muromonab-Cd3 Biosimilar has been primarily used in the treatment of acute rejection in solid organ transplantation. It has also been investigated as a potential therapy for autoimmune diseases, such as type 1 diabetes and multiple sclerosis. In addition, this biosimilar antibody has shown promising results in the treatment of certain types of cancer, such as T-cell lymphoma and leukemia.

Future Directions

The development of Muromonab-Cd3 Biosimilar has opened up new possibilities for the treatment of various diseases. As a biosimilar, it offers a more affordable alternative to the original monoclonal antibody, making it more accessible for patients. In the future, further research and clinical trials will be needed to fully understand the potential of this antibody in various disease settings.

Conclusion

In summary, Muromonab-Cd3 Biosimilar is a research grade antibody that targets the CD3E protein. It has both activating and immunosuppressive effects on T-cells, and has potential applications in research and clinical settings. As a biosimilar, it offers a more affordable option for patients in need of this therapy. Further research and clinical trials will continue to expand our understanding of the potential of this antibody in the treatment of various diseases.

SDS-PAGE for Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade

SDS-PAGE for Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade

Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Muromonab-Cd3 Biosimilar – Anti-CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products