Brand: ProteoGenix

Human CD3E (OKT3) Monoclonal Antibody

ARO-A15835-50
Validated ELISA FC

Original price was: $418.00.Current price is: $326.00.

50ug 22% OFF + 326 loyalty points

Size Size

50ug Original price was: $418.00.Current price is: $326.00.
100ug Original price was: $568.00.Current price is: $465.00.
1MG Original price was: $1,620.00.Current price is: $1,349.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human CD3E (OKT3) Monoclonal Antibody binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Flow Cytometry results for Human CD3E (OKT3) Monoclonal Antibody

Datasheet

49 clones available

Human CD3E (OKT3) Monoclonal Antibody

Product name	ARO-A15835-100
Uniprot ID	P07766
Uniprot link	P07766
Raw Antigen Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference	ARO-A15835
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD3E (OKT3)
Clone Name	OKT3
Protein Name	CD3E (OKT3)
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15835-1MG
Uniprot ID	P07766
Uniprot link	P07766
Raw Antigen Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference	ARO-A15835
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD3E (OKT3)
Clone Name	OKT3
Protein Name	CD3E (OKT3)
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15835-50
Uniprot ID	P07766
Uniprot link	P07766
Raw Antigen Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference	ARO-A15835
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CD3E (OKT3)
Clone Name	OKT3
Protein Name	CD3E (OKT3)
Target species	Anti-Human Monoclonal Antibody

Datasheet

Human CD3E (OKT3) Monoclonal Antibody binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Recombinant Human CD3E Protein, N-His(cat. No.ARO-P10225) at 0.5Âµg/mL (100ÂµL/well) can bind Human CD3E (OKT3) Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Human CD3E (OKT3) Monoclonal Antibody

Flow-cytometry using anti-human CD3E antibody. Human Jurkat cell line were stained with an irrelevant antibody (Green Histogram) or an anti-human CD3E antibody monoclonal antibody (Catalog # ARO-A15835 , Red Histogram) at a concentration of 20 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a CoraLite488 conjugated goat anti-mouse antibody (Catalog # PTX17816) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Human CD3E (OKT3) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Filter to find the right variant

Clonality

All

Target Species

All

Applications

All

Clone Name

All

Name	SKU	View Clone
Anti-Human CD3 Antibody (TR66), PE	ARO-A10567	View Clone
Anti-Human CD3 Antibody (SP34), FITC	ARO-A10810	View Clone
Anti-Human CD3 Antibody (SP34), PE	ARO-A10569	View Clone
Anti-Human CD3 Antibody (TR66), APC	ARO-A10298	View Clone
Anti-Human CD3 Antibody (UCHT1)	ARO-A15384	View Clone
Anti-Human CD3 Antibody (SP34), APC	ARO-A10300	View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade	PX-TA1092	View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade	PX-TA1169	View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade	PX-TA1617	View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade	PX-TA1066	View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade	PX-TA1245	View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade	PX-TA1652	View Clone
Human CD3E (OKT3) Monoclonal Antibody	ARO-A15835	View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody	ARO-A15838	View Clone
Human CD3E (UCHT-1) Monoclonal Antibody	ARO-A15841	View Clone
Human CD3E Monoclonal Antibody	ARO-A15844	View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC	ARO-A10814	View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC	ARO-A10813	View Clone
Anti-Human CD3E Antibody (OKT3), FITC	ARO-A10812	View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC	ARO-A10811	View Clone
Anti-Human CD3 Antibody (UCHT1), FITC	ARO-A10809	View Clone
Anti-Human CD3 Antibody (TR66), FITC	ARO-A10504	View Clone
Anti-Human CD3E Antibody (TRX4), FITC	ARO-A10808	View Clone
Anti-Human CD3 Antibody (HIT3a), FITC	ARO-A10807	View Clone
Anti-Human CD3E Antibody (YTH12.5), APC	ARO-A10304	View Clone
Anti-Human CD3E Antibody (UCHT-1), APC	ARO-A10303	View Clone
Anti-Human CD3E Antibody (OKT3), APC	ARO-A10302	View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC	ARO-A10301	View Clone
Anti-Human CD3 Antibody (UCHT1), APC	ARO-A10299	View Clone
Anti-Human CD3E Antibody (TRX4), APC	ARO-A10297	View Clone
Anti-Human CD3 Antibody (HIT3a), APC	ARO-A10296	View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP	ARO-A10053	View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP	ARO-A10052	View Clone
Anti-Human CD3E Antibody (OKT3), PerCP	ARO-A10051	View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP	ARO-A10050	View Clone
Anti-Human CD3 Antibody (SP34), PerCP	ARO-A10049	View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP	ARO-A10048	View Clone
Anti-Human CD3 Antibody (TR66), PerCP	ARO-A10047	View Clone
Anti-Human CD3E Antibody (TRX4), PerCP	ARO-A10046	View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP	ARO-A10045	View Clone
Anti-Human CD3E Antibody (YTH12.5), PE	ARO-A10573	View Clone
Anti-Human CD3E Antibody (UCHT-1), PE	ARO-A10572	View Clone
Anti-Human CD3E Antibody (OKT3), PE	ARO-A10571	View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE	ARO-A10570	View Clone
Anti-Human CD3 Antibody (UCHT1), PE	ARO-A10568	View Clone
Anti-Human CD3E Antibody (TRX4), PE	ARO-A10566	View Clone
Anti-Human CD3 Antibody (HIT3a), PE	ARO-A10565	View Clone
Anti-Human CD3E VHH (SAA1330)	PTX18928-100	View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#)	ARO-A13054	View Clone