Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Otelixizumab Biosimilar – Anti-CD3E mAb – Research Grade

  • PX-TA1169-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade

Product name Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 881191-44-2
Species Chimeric,Humanized
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Otelixizumab,ChAglyCD,TRX4,CD3E,anti-CD3E
Reference PX-TA1169
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 881191-44-2
Species Chimeric,Humanized
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Otelixizumab,ChAglyCD,TRX4,CD3E,anti-CD3E
Reference PX-TA1169
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1169-50
Uniprot ID P07766
Source CAS 881191-44-2
Species Chimeric,Humanized
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Otelixizumab,ChAglyCD,TRX4,CD3E,anti-CD3E
Reference PX-TA1169
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Otelixizumab biosimilar, also known as Anti-CD3E mAb, is a monoclonal antibody that specifically targets the CD3E subunit of the T-cell receptor complex. It is a research grade antibody that has shown promising results in preclinical studies and is being investigated for its potential therapeutic applications in various diseases.

Structure

Otelixizumab biosimilar is a humanized IgG1 monoclonal antibody, meaning it contains both human and mouse components. It is composed of two heavy chains and two light chains, each with a variable region that binds to the CD3E subunit and a constant region that mediates effector functions. The antibody has a molecular weight of approximately 150 kDa and a half-life of 21 days.

Activity

The main function of Otelixizumab biosimilar is to bind to the CD3E subunit on the surface of T-cells and modulate their activity. CD3E is a critical component of the T-cell receptor complex, and its binding by Otelixizumab biosimilar leads to the activation of T-cells and subsequent immune responses. This can include the production of cytokines, proliferation, and differentiation of T-cells.

Application

Otelixizumab biosimilar has shown potential in various diseases where T-cells play a crucial role in the pathogenesis. One of the most promising applications is in the treatment of autoimmune diseases such as type 1 diabetes, multiple sclerosis, and rheumatoid arthritis. In these diseases, T-cells mistakenly attack the body’s own tissues, leading to chronic inflammation and tissue damage. By targeting the CD3E subunit, Otelixizumab biosimilar can modulate the activity of T-cells and potentially reduce the severity of these diseases.

In addition to autoimmune diseases, Otelixizumab biosimilar is also being investigated for its potential in transplant rejection. When a transplanted organ is recognized as foreign by the recipient’s immune system, T-cells are activated and attack the organ, leading to rejection. By targeting the CD3E subunit, Otelixizumab biosimilar can potentially prevent or reduce the activation of T-cells and improve the success rate of organ transplantation.

Furthermore, Otelixizumab biosimilar has shown promise in the treatment of certain types of cancer. T-cells play a crucial role in the body’s immune response against cancer cells, and by targeting the CD3E subunit, Otelixizumab biosimilar can potentially enhance the activity of T-cells and improve their ability to kill cancer cells. This is particularly relevant in hematological malignancies such as leukemia and lymphoma, where T-cells are the main effector cells in immunotherapy.

Conclusion

In conclusion, Otelixizumab biosimilar is a research grade monoclonal antibody that specifically targets the CD3E subunit of the T-cell receptor complex. Its main function is to modulate the activity of T-cells, and it has shown potential in various diseases where T-cells play a crucial role. With ongoing research and clinical trials, Otelixizumab biosimilar has the potential to become a valuable therapeutic option in the treatment of autoimmune diseases, transplant rejection, and certain types of cancer.

SDS-PAGE for Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade

SDS-PAGE for Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Recombinant Human CD3E Protein, N-His(cat. No.ARO-P10225) at 0.5µg/mL (100µL/well) can bind Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Otelixizumab Biosimilar – Anti-CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products