Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Visilizumab Biosimilar – Anti-CD3E mAb – Research Grade

  • PX-TA1066-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2-nd

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade

Product name Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 219716-33-3
Species Humanized
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Visilizumab,HuM291,CD3E,anti-CD3E
Reference PX-TA1066
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody
Product name Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 219716-33-3
Species Humanized
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Visilizumab,HuM291,CD3E,anti-CD3E
Reference PX-TA1066
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody
Product name PX-TA1066-50
Uniprot ID P07766
Source CAS 219716-33-3
Species Humanized
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Visilizumab,HuM291,CD3E,anti-CD3E
Reference PX-TA1066
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody

Introduction

Visilizumab Biosimilar, also known as Anti-CD3E mAb, is a monoclonal antibody that targets the CD3E protein, a key component of the T-cell receptor complex. This biosimilar is a research grade version of the original Visilizumab, which was developed as a therapeutic antibody for the treatment of autoimmune diseases. In this article, we will explore the structure, activity, and potential applications of this biosimilar.

Structure of Visilizumab Biosimilar

Visilizumab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced in a laboratory using DNA technology and is modified to have a human-like structure. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the CD3E protein, while the constant region determines the antibody’s effector functions.

The antibody has a molecular weight of approximately 150 kDa and is composed of 1,330 amino acids. It has a similar structure to the original Visilizumab, with a high degree of sequence homology. This ensures that the biosimilar has similar binding properties and potential therapeutic effects as the original antibody.

Activity of Visilizumab Biosimilar

Visilizumab Biosimilar specifically targets the CD3E protein, which is found on the surface of T-cells. T-cells play a crucial role in the immune response, and the CD3E protein is essential for T-cells to function properly. By binding to the CD3E protein, Visilizumab Biosimilar can modulate the activity of T-cells and regulate the immune response.

One of the main mechanisms of action of Visilizumab Biosimilar is through the depletion of T-cells. By binding to the CD3E protein, the antibody triggers T-cell apoptosis, leading to a decrease in the total number of T-cells in the body. This can be beneficial in autoimmune diseases, where there is an overactive immune response, as it helps to reduce inflammation and tissue damage.

Additionally, Visilizumab Biosimilar can also modulate the activity of T-cells by blocking the interaction between the CD3E protein and other co-receptors, such as CD28. This interaction is crucial for T-cell activation and proliferation, and by inhibiting it, the antibody can further suppress the immune response.

Potential Applications of Visilizumab Biosimilar

Visilizumab Biosimilar has shown promising results in preclinical studies for the treatment of various autoimmune diseases, including type 1 diabetes, rheumatoid arthritis, and multiple sclerosis. It has also been investigated as a potential therapy for transplant rejection and graft-versus-host disease.

In addition to its potential therapeutic applications, Visilizumab Biosimilar can also be used as a research tool to study the role of T-cells in the immune response. Its ability to specifically target the CD3E protein makes it a valuable tool for studying T-cell function and the mechanisms of autoimmune diseases.

Conclusion

In summary, Visilizumab Biosimilar is a research grade version of the original Visilizumab antibody, which targets the CD3E protein on T-cells. Its structure, activity, and potential applications make it a promising candidate for the treatment of autoimmune diseases and a valuable tool for research in the field of immunology. Further studies and clinical trials are needed to fully understand the potential of this biosimilar in the treatment of various diseases.

SDS-PAGE for Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade

SDS-PAGE for Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade

Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Recombinant Human CD3E Protein, N-His(cat. No.ARO-P10225) at 0.5µg/mL (100µL/well) can bind Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Visilizumab Biosimilar – Anti-CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products