Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Teplizumab Biosimilar – Anti-CD3 mAb – Research Grade

  • PX-TA1617-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody

Original price was: $328.00.Current price is: $238.00.

100ug 27% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade

Product name Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade
Uniprot ID P07766
Source CAS 876387-05-2
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Teplizumab,MGA-031/MGA031;PRV-031,CD3,anti-CD3
Reference PX-TA1617
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade
Uniprot ID P07766
Source CAS 876387-05-2
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Teplizumab,MGA-031/MGA031;PRV-031,CD3,anti-CD3
Reference PX-TA1617
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name PX-TA1617-50
Uniprot ID P07766
Source CAS 876387-05-2
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Teplizumab,MGA-031/MGA031;PRV-031,CD3,anti-CD3
Reference PX-TA1617
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody

Teplizumab Biosimilar – Anti-CD3 mAb – Research Grade

Teplizumab Biosimilar – Anti-CD3 mAb – Research Grade: A Promising Antibody for Targeted Therapy

Introduction

Teplizumab Biosimilar, also known as Anti-CD3 monoclonal antibody (mAb), is a novel therapeutic antibody that has shown promising results in the treatment of various autoimmune diseases. It is a biosimilar version of the FDA-approved drug Teplizumab, which is used for the treatment of type 1 diabetes. This research grade antibody has been extensively studied for its structure, activity, and potential applications in the field of targeted therapy.

Structure of Teplizumab Biosimilar

Teplizumab Biosimilar is a humanized IgG1 monoclonal antibody that specifically targets the CD3 antigen on T-cells. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to the CD3 antigen, while the constant region mediates effector functions such as complement-dependent cytotoxicity and antibody-dependent cellular cytotoxicity.

The structure of Teplizumab Biosimilar is highly similar to that of the original Teplizumab, with minor differences in the amino acid sequence. This biosimilar version has been carefully engineered to maintain the same binding affinity and specificity as the original drug, while also ensuring a high level of purity and stability. This makes it a reliable and effective therapeutic option for targeted therapy.

Activity of Teplizumab Biosimilar

Teplizumab Biosimilar works by binding to the CD3 antigen on T-cells, which are a key component of the immune system. This binding leads to the activation of T-cells and subsequent suppression of immune response. In autoimmune diseases, the immune system mistakenly attacks healthy cells and tissues, causing inflammation and damage. By targeting and inhibiting the activity of T-cells, Teplizumab Biosimilar helps to reduce this harmful immune response and alleviate symptoms of autoimmune diseases.

Studies have shown that Teplizumab Biosimilar has a high affinity for the CD3 antigen, allowing it to effectively block T-cell activation. It has also been found to have a long half-life, which means it can remain in the body for an extended period of time, providing sustained therapeutic effects.

Applications of Teplizumab Biosimilar

Teplizumab Biosimilar has been primarily studied for its potential applications in the treatment of autoimmune diseases such as type 1 diabetes, multiple sclerosis, and rheumatoid arthritis. In clinical trials, it has shown promising results in reducing disease activity and improving symptoms in patients with these conditions.

Additionally, Teplizumab Biosimilar has also been investigated for its potential use in organ transplantation. By suppressing T-cell activity, it can help prevent organ rejection and improve transplant outcomes. Furthermore, this antibody has also shown potential in the treatment of certain types of cancer, as it can induce apoptosis (cell death) in cancer cells.

Conclusion

Teplizumab Biosimilar, a biosimilar version of the FDA-approved drug Teplizumab, is a promising antibody for targeted therapy. Its highly similar structure and activity to the original drug, along with its potential applications in various autoimmune diseases and transplantation, make it a valuable addition to the field of medicine. Further research and clinical trials are needed to fully understand the potential of this biosimilar in improving the lives of patients with autoimmune diseases and other conditions.

SDS-PAGE for Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade

SDS-PAGE for Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade in ELISA Assay

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade in ELISA Assay

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Teplizumab Biosimilar – Anti-CD3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products