Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

C-type lectin domain family 9 member A(CLEC9A)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q6UXN8
Molecular weight:
24.35kDa

$217.00

+ 217 loyalty points
Lys57–Val241
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
C-type lectin domain family 9 member A(CLEC9A)

C-type lectin domain family 9 member A(CLEC9A)

Product name C-type lectin domain family 9 member A(CLEC9A)
Uniprot ID Q6UXN8
Uniprot link https://www.uniprot.org/uniprot/Q6UXN8
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAMAKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCP NNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSP SPGLLPAERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSVGSHHHHHH
Molecular weight 24.35kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys57-Val241
Aliases /Synonyms CD370
Reference PX-P4353
Note For research use only
Molecular Constructor
Lys57–Val241
Product name C-type lectin domain family 9 member A(CLEC9A)
Uniprot ID Q6UXN8
Uniprot link https://www.uniprot.org/uniprot/Q6UXN8
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAMAKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCP NNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSP SPGLLPAERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSVGSHHHHHH
Molecular weight 24.35kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys57-Val241
Aliases /Synonyms CD370
Reference PX-P4353
Note For research use only
Molecular Constructor
Lys57–Val241

There are no reviews yet.

Be the first to review “C-type lectin domain family 9 member A(CLEC9A)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products