Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Peroxisome proliferator-activated receptor alpha(PPARA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q07869
Molecular weight:
31.6kDa

$392.00

100ug + 392 loyalty points
Ala201–Tyr468 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Peroxisome proliferator-activated receptor alpha(PPARA)

Product name Peroxisome proliferator-activated receptor alpha(PPARA)
Uniprot ID Q07869
Uniprot link https://www.uniprot.org/uniprot/Q07869
Expression system Prokaryotic expression
Raw Antigen Sequence MGADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMYLEHHHHHH
Molecular weight 31.6kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala201-Tyr468
Protein Accession Q07869
Spec:Entrez GeneID 5465
Spec:NCBI Gene Aliases PPAR; NR1C1; hPPAR; PPARalpha
Spec:SwissProtID Q16241
NCBI Reference Q07869
Aliases /Synonyms Nuclear receptor subfamily 1 group C member 1,NR1C1, PPAR
Reference PX-P4597
Note For research use only
Molecular Constructor
Ala201–Tyr468 His
Product name Peroxisome proliferator-activated receptor alpha(PPARA)
Uniprot ID Q07869
Uniprot link https://www.uniprot.org/uniprot/Q07869
Expression system Prokaryotic expression
Raw Antigen Sequence MGADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMYLEHHHHHH
Molecular weight 31.6kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala201-Tyr468
Protein Accession Q07869
Spec:Entrez GeneID 5465
Spec:NCBI Gene Aliases PPAR; NR1C1; hPPAR; PPARalpha
Spec:SwissProtID Q16241
NCBI Reference Q07869
Aliases /Synonyms Nuclear receptor subfamily 1 group C member 1,NR1C1, PPAR
Reference PX-P4597
Note For research use only
Molecular Constructor
Ala201–Tyr468 His

There are no reviews yet.

Be the first to review “Peroxisome proliferator-activated receptor alpha(PPARA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products