Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

PfEMP1 variant 1 of strain MC ( MCvar-1 PfEMP1)

Host species:
Mammalian cells
Uniprot ID:
Q25733
Molecular weight:
24.2kDa

Original price was: $370.00.Current price is: $308.00.

50ug 17% OFF + 308 loyalty points
Glu576–Pro745 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

PfEMP1 variant 1 of strain MC ( MCvar-1 PfEMP1)

Product name PfEMP1 variant 1 of strain MC ( MCvar-1 PfEMP1)
Uniprot ID Q25733
Uniprot link https://www.uniprot.org/uniprot/Q25733
Expression system Eukaryotic expression
Raw Antigen Sequence EDKIMSYNAFFWMWVHDMLIDSIKWRDEHGRCINKDKGKTCIKGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCLKTHTDDTCPP
Molecular weight 24.2kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu576-Pro745
Protein Accession Q25733
Spec:SwissProtID Q25733
NCBI Reference Q25733
Reference PX-P4676
Note For research use only
Molecular Constructor
Glu576–Pro745 His
Product name PfEMP1 variant 1 of strain MC ( MCvar-1 PfEMP1)
Uniprot ID Q25733
Uniprot link https://www.uniprot.org/uniprot/Q25733
Expression system Eukaryotic expression
Raw Antigen Sequence EDKIMSYNAFFWMWVHDMLIDSIKWRDEHGRCINKDKGKTCIKGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCLKTHTDDTCPP
Molecular weight 24.2kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu576-Pro745
Protein Accession Q25733
Spec:SwissProtID Q25733
NCBI Reference Q25733
Reference PX-P4676
Note For research use only
Molecular Constructor
Glu576–Pro745 His
Product name PX-P4676-1MG
Uniprot ID Q25733
Uniprot link https://www.uniprot.org/uniprot/Q25733
Expression system Eukaryotic expression
Raw Antigen Sequence EDKIMSYNAFFWMWVHDMLIDSIKWRDEHGRCINKDKGKTCIKGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCLKTHTDDTCPP
Molecular weight 24.2kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu576-Pro745
Protein Accession Q25733
Spec:SwissProtID Q25733
NCBI Reference Q25733
Reference PX-P4676
Note For research use only
Molecular Constructor
Glu576–Pro745 His

PfEMP1 variant 1 of strain MC ( MCvar-1 PfEMP1)

There are no reviews yet.

Be the first to review “PfEMP1 variant 1 of strain MC ( MCvar-1 PfEMP1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products