Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Picankibart Biosimilar – Anti-SGRF mAb – Research Grade

  • PX-TA1963-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Picankibart Biosimilar - Anti-SGRF mAb - Research Grade

Product name Picankibart Biosimilar - Anti-SGRF mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS: 2622900-74-5
Species Human
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-SGRF, IL-23-A, IL-23 subunit alpha, Interleukin-23 subunit p19, IL23A, Interleukin-23 subunit alpha, IL-23p19
Reference PX-TA1963
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Picankibart Biosimilar - Anti-SGRF mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS: 2622900-74-5
Species Human
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-SGRF, IL-23-A, IL-23 subunit alpha, Interleukin-23 subunit p19, IL23A, Interleukin-23 subunit alpha, IL-23p19
Reference PX-TA1963
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1963-50
Uniprot ID Q9NPF7
Source CAS: 2622900-74-5
Species Human
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-SGRF, IL-23-A, IL-23 subunit alpha, Interleukin-23 subunit p19, IL23A, Interleukin-23 subunit alpha, IL-23p19
Reference PX-TA1963
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Picankibart Biosimilar – Anti-SGRF mAb

Picankibart Biosimilar – Anti-SGRF mAb is a novel biosimilar antibody that targets the SGRF (spleen growth factor receptor) protein. This monoclonal antibody (mAb) is specifically designed to mimic the activity of the original Picankibart antibody, which has shown promising results in pre-clinical and clinical studies. In this article, we will explore the structure, activity, and potential applications of this biosimilar antibody in the field of therapeutic research.

Structure of Picankibart Biosimilar – Anti-SGRF mAb

Picankibart Biosimilar – Anti-SGRF mAb is a recombinant humanized IgG1 monoclonal antibody that is produced in a mammalian cell expression system. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a unique amino acid sequence that is specifically designed to bind to the SGRF protein with high affinity and specificity.

Activity of Picankibart Biosimilar – Anti-SGRF mAb

The primary function of Picankibart Biosimilar – Anti-SGRF mAb is to inhibit the activity of the SGRF protein. SGRF is a cytokine that is involved in the regulation of cell growth and differentiation. It has been implicated in various diseases, including cancer and autoimmune disorders. By binding to SGRF, Picankibart Biosimilar – Anti-SGRF mAb prevents its interaction with its receptor, thereby blocking its signaling pathway and inhibiting its activity.

Title: Potential Applications of Picankibart Biosimilar – Anti-SGRF mAb

Due to its ability to inhibit the activity of SGRF, Picankibart Biosimilar – Anti-SGRF mAb has potential applications in various therapeutic areas. It has been shown to have anti-tumor activity in pre-clinical studies, making it a promising candidate for cancer treatment. Additionally, SGRF has been implicated in autoimmune disorders such as rheumatoid arthritis and psoriasis, making Picankibart Biosimilar – Anti-SGRF mAb a potential treatment option for these conditions.

Advantages of Picankibart Biosimilar – Anti-SGRF mAb

One of the main advantages of Picankibart Biosimilar – Anti-SGRF mAb is its similarity to the original Picankibart antibody. This ensures that the biosimilar antibody has similar efficacy and safety profiles as the original, making it a reliable and effective treatment option. Additionally, as a biosimilar, it is more cost-effective compared to the original antibody, making it more accessible to patients.

Title: Clinical Development of Picankibart Biosimilar – Anti-SGRF mAb

Picankibart Biosimilar – Anti-SGRF mAb is currently in the pre-clinical stage of development. Extensive studies are being conducted to evaluate its safety and efficacy in various disease models. These studies will provide valuable data to support its potential use as a therapeutic agent in clinical trials.

Conclusion

In conclusion, Picankibart Biosimilar – Anti-SGRF mAb is a promising biosimilar antibody that targets the SGRF protein. Its unique structure and activity make it a potential treatment option for various diseases, including cancer and autoimmune disorders. As it progresses through the clinical development process, it has the potential to provide a more accessible and cost-effective treatment option for patients.

Research Grade Picankibart in ELISA Assay

Research Grade Picankibart in ELISA Assay

Research Grade Picankibart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Picankibart

SDS-PAGE for Research Grade Picankibart

Research Grade Picankibart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Picankibart Biosimilar - Anti-SGRF mAb - Research Grade

There are no reviews yet.

Be the first to review “Picankibart Biosimilar – Anti-SGRF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products