Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Plasmodium falciparum PF10Nter Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Plasmodium falciparum
Uniprot ID:
Q8IK14
Molecular weight:
95,44 kDa

$810.00

100ug + 810 loyalty points
Partial
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Plasmodium falciparum PF10Nter Recombinant Protein

Plasmodium falciparum PF10Nter Recombinant Protein

Product name Plasmodium falciparum PF10Nter Recombinant Protein
Uniprot ID Q8IK14
Uniprot link http://www.uniprot.org/uniprot/Q8IK14
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMQINPMEKS SFVQTRIFPPKPTIFSLEKNDDFLNTHNEGFLILSYCFAISLFMYIVLKNLYYLYIFKRTRIKIIESLNNDNNVENEIEE MKRVKNLIMEQVIHELMRKSIISKRRTRKDIETDLSQNVRNEDMNLKENEIEMTQVETLKHLIHNNLLTEFHDTKEKNLE SFIKFLQQLMTLEKNEKEFSNNILVKDLMDYIINIGKKEIQKSNTQLSQASSQNYIPSNENDIYIFQIQVIKELLKNNII ITHSNDGKQLDDEIITKILEESLMSQANVVEYFYIEMIKNILGNDYNELNAISYTHDDLYLQKYEKELIKKKLSQYAYKN MNTKQNNKYVQDKTVNKHIHKNQIEQNEATTNLIEKENTFEKTNKFDNNGMIQNNIPIQAETNDESMKNIIQHKELLKNH DKENKNEEIENMNQHKKEECNYNDKKAVTEHSKKSRKNFKRKCMKKRDIRHLYQIDKLQDKILKNLMGQDSIESDSKNND IQQLEEQKSDIQNEKLATSNEQEETRNTNNEHKENEVNMDQNNMKLNIYNLNNQDIQNHYDKNVKEKLEEENILSDNIIK HHHHHH
Molecular weight 95,44 kDa
Purity estimated 80%
Buffer TrisHC 50mMl, 10mM reduced glutathion pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_001347311.1*
Spec:Entrez GeneID 810184
Spec:SwissProtID Q8IK14
NCBI Reference XP_001347311.1*
Aliases /Synonyms PF10Nter , Tryptophan-rich antigen 3, putative, PF10_0026, PF3D7_1002200
Reference PX-P1139
Note For research use only
Molecular Constructor
Partial
Product name Plasmodium falciparum PF10Nter Recombinant Protein
Uniprot ID Q8IK14
Uniprot link http://www.uniprot.org/uniprot/Q8IK14
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMQINPMEKS SFVQTRIFPPKPTIFSLEKNDDFLNTHNEGFLILSYCFAISLFMYIVLKNLYYLYIFKRTRIKIIESLNNDNNVENEIEE MKRVKNLIMEQVIHELMRKSIISKRRTRKDIETDLSQNVRNEDMNLKENEIEMTQVETLKHLIHNNLLTEFHDTKEKNLE SFIKFLQQLMTLEKNEKEFSNNILVKDLMDYIINIGKKEIQKSNTQLSQASSQNYIPSNENDIYIFQIQVIKELLKNNII ITHSNDGKQLDDEIITKILEESLMSQANVVEYFYIEMIKNILGNDYNELNAISYTHDDLYLQKYEKELIKKKLSQYAYKN MNTKQNNKYVQDKTVNKHIHKNQIEQNEATTNLIEKENTFEKTNKFDNNGMIQNNIPIQAETNDESMKNIIQHKELLKNH DKENKNEEIENMNQHKKEECNYNDKKAVTEHSKKSRKNFKRKCMKKRDIRHLYQIDKLQDKILKNLMGQDSIESDSKNND IQQLEEQKSDIQNEKLATSNEQEETRNTNNEHKENEVNMDQNNMKLNIYNLNNQDIQNHYDKNVKEKLEEENILSDNIIK HHHHHH
Molecular weight 95,44 kDa
Purity estimated 80%
Buffer TrisHC 50mMl, 10mM reduced glutathion pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_001347311.1*
Spec:Entrez GeneID 810184
Spec:SwissProtID Q8IK14
NCBI Reference XP_001347311.1*
Aliases /Synonyms PF10Nter , Tryptophan-rich antigen 3, putative, PF10_0026, PF3D7_1002200
Reference PX-P1139
Note For research use only
Molecular Constructor
Partial

General information on Plasmodium falciparum PF10Nter Recombinant Protein

Tryptophan-rich protein expressed in the late stage schizonts and merozoite stages and because of its association with the surface of merozoites. The protein is localized on the surface of merozoites. The characteristic of the protein is similar to a P. yoelii antigen, pypAg-3, which have been successfully used in vaccination studies in mice. The conservation and uniqueness of the tryptophan-rich domains in plasmodial species, is anindication that it may be an important and essential feature of parasite function.

  • Ntumngia FB, Bouyou-Akotet MK, Uhlemann AC, Mordmüller B, Kremsner PG, Kun JF. Characterisation of a tryptophan-rich Plasmodium falciparum antigen associated with merozoites. Mol Biochem Parasitol. 2004 Oct;137(2):349-53. PubMed PMID: 15383306.
  • LaCount DJ, Vignali M, Chettier R, Phansalkar A, Bell R, Hesselberth JR, Schoenfeld LW, Ota I, Sahasrabudhe S, Kurschner C, Fields S, Hughes RE. A protein interaction network of the malaria parasite Plasmodium falciparum. Nature. 2005 Nov 3;438(7064):103-7. PubMed PMID: 16267556.
  • Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B. Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. PubMed PMID: 12368864; PubMed Central PMCID: PMC3836256.

There are no reviews yet.

Be the first to review “Plasmodium falciparum PF10Nter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products