Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rat AADAT Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Rat
Uniprot ID:
Q64602
Molecular weight:
45.74 kDa

Original price was: $352.00.Current price is: $271.00.

50ug 23% OFF + 271 loyalty points
GST Val271–Ser425 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rat AADAT Recombinant Protein, N-GST & C-His

Product name ARO-P19022-100
Uniprot ID Q64602
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence VGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQLIKDVS
Molecular weight 45.74 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val271-Ser425
Aliases /Synonyms 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, AADAT, AadAT, Alpha-aminoadipate aminotransferase, EC:2.6.1.39, EC:2.6.1.4, EC:2.6.1.63, EC:2.6.1.7, EC:2.6.1.73, Glycine transaminase AADAT, KAT/AadAT, KAT2, KYAT2, Kynurenine aminotransferase II, Kynurenine--glyoxylate transaminase AADAT, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase 2, Kynurenine--oxoglutarate transaminase II, Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, Methionine--glyoxylate transaminase AADAT
Reference ARO-P19022
Note For research use only.
Molecular Constructor
GST Val271–Ser425 His
Product name ARO-P19022-1MG
Uniprot ID Q64602
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence VGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQLIKDVS
Molecular weight 45.74 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val271-Ser425
Aliases /Synonyms 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, AADAT, AadAT, Alpha-aminoadipate aminotransferase, EC:2.6.1.39, EC:2.6.1.4, EC:2.6.1.63, EC:2.6.1.7, EC:2.6.1.73, Glycine transaminase AADAT, KAT/AadAT, KAT2, KYAT2, Kynurenine aminotransferase II, Kynurenine--glyoxylate transaminase AADAT, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase 2, Kynurenine--oxoglutarate transaminase II, Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, Methionine--glyoxylate transaminase AADAT
Reference ARO-P19022
Note For research use only.
Molecular Constructor
GST Val271–Ser425 His
Product name ARO-P19022-50
Uniprot ID Q64602
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence VGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQLIKDVS
Molecular weight 45.74 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val271-Ser425
Aliases /Synonyms 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, AADAT, AadAT, Alpha-aminoadipate aminotransferase, EC:2.6.1.39, EC:2.6.1.4, EC:2.6.1.63, EC:2.6.1.7, EC:2.6.1.73, Glycine transaminase AADAT, KAT/AadAT, KAT2, KYAT2, Kynurenine aminotransferase II, Kynurenine--glyoxylate transaminase AADAT, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase 2, Kynurenine--oxoglutarate transaminase II, Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, Methionine--glyoxylate transaminase AADAT
Reference ARO-P19022
Note For research use only.
Molecular Constructor
GST Val271–Ser425 His

There are no reviews yet.

Be the first to review “Rat AADAT Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products