Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant ASFV E248R/Ba71V-132 Protein, C-Fc

Host species:
Mammalian cells
Origin species:
African swine fever virus
Uniprot ID:
Q65200
Molecular weight:
50.18 kDa

Original price was: $388.00.Current price is: $350.00.

50ug 10% OFF + 350 loyalty points
Gly2–Asn199 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant ASFV E248R/Ba71V-132 Protein, C-Fc

Product name ARO-P15977-100
Uniprot ID Q65200
Origin species African swine fever virus
Expression system Eukaryotic expression
Raw Antigen Sequence GGSTSKNSFKNTTNIISNSIFNQMQNCISMLDGKNYIGVFGDGNILNHVFQDLNLSLDTSCVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLTTTLIQNCVSSLSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYTSKNFFDFIADAISAVFKN
Molecular weight 50.18 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Asn199
Aliases /Synonyms Inner membrane protein pE248R, pE248R, Ba71V-132, E248R
Reference ARO-P15977
Note For research use only.
Molecular Constructor
Gly2–Asn199 Fc
Product name ARO-P15977-1MG
Uniprot ID Q65200
Origin species African swine fever virus
Expression system Eukaryotic expression
Raw Antigen Sequence GGSTSKNSFKNTTNIISNSIFNQMQNCISMLDGKNYIGVFGDGNILNHVFQDLNLSLDTSCVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLTTTLIQNCVSSLSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYTSKNFFDFIADAISAVFKN
Molecular weight 50.18 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Asn199
Aliases /Synonyms Inner membrane protein pE248R, pE248R, Ba71V-132, E248R
Reference ARO-P15977
Note For research use only.
Molecular Constructor
Gly2–Asn199 Fc
Product name ARO-P15977-50
Uniprot ID Q65200
Origin species African swine fever virus
Expression system Eukaryotic expression
Raw Antigen Sequence GGSTSKNSFKNTTNIISNSIFNQMQNCISMLDGKNYIGVFGDGNILNHVFQDLNLSLDTSCVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLTTTLIQNCVSSLSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYTSKNFFDFIADAISAVFKN
Molecular weight 50.18 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Asn199
Aliases /Synonyms Inner membrane protein pE248R, pE248R, Ba71V-132, E248R
Reference ARO-P15977
Note For research use only.
Molecular Constructor
Gly2–Asn199 Fc

There are no reviews yet.

Be the first to review “Recombinant ASFV E248R/Ba71V-132 Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products